The URL can be used to link to this page

Home My WebLink AboutStaff Report 12245 CITY OF PALO ALTO OFFICE OF THE CITY CLERK April 28, 2021 The Honorable City Council Palo Alto, California Interviews of Candidates for the Human Relations Commission, Public Art Commission, Storm Water Management Oversight Committee, and Utilities Advisory Commission On March 2, 2021, the City Clerk’s Office ope ned the recruitment for the Human Relations Commission (HRC), Public Art Commission (PAC), Stormwater Management Oversight Committee (SWMOC), and Utilities Advisory Commission (UAC). During this recruitment, the Clerk’s Office received 25 applications. On April 19, 2021, Council voted to interview all applicants for these positions. The interview schedule is as follows: Sunita de Tourreil 6:00 HRC Adriana Eberle 6:10 HRC Michelle Kraus 6:20 HRC Angeli Patel 6:30 HRC Shiraaz Bhabha 6:40 PAC Loren Gordon 6:50 PAC Mette Huberman 7:00 PAC Ian Klaus 7:10 PAC Emily Meyer 7:20 PAC Ben Miyaji 7:30 PAC Cleia Muggler 7:40 PAC Harriet Stern 7:50 PAC Lisa Waltuch 8:00 PAC Mark Weiss 8:10 PAC BREAK 8:20 Stephanie MacDonald 8:30 SWMOC Hal Mickelson 8:40 SWMOC Dena Mossar 8:50 SWMOC Catherine Perman 9:00 SWMOC Bob Wenzlau 9:10 SWMOC John Bowie 9:20 UAC Carol Guthrie 9:30 UAC Don Jackson 9:40 UAC Phil Metz 9:50 UAC Rajmohan Rajagopalan 10:00 UAC Page 2 HRC candidate Kaloma Smith is unable to attend the interviews, but it still eligible to be considered for re-appointment. Copies of the applications are attached to this Staff Report. This recruitment was advertised on the City’s website, social media, Daily Post newspaper, Palo Alto Online, and inclusion in the weekly Council Packet GovDelivery e- mail notifications. The application deadline was Tuesday, April 6, 2021. Background On May 17, 2021, the City Council is scheduled to vote to appoint candidates to the following positions: • Three (3) positions on the Human Relations Commission, with three-year terms ending May 31, 2024. • Three (3) positions on the Public Art Commission, with three -year terms ending May 31, 2024. • Four (4) positions on the Storm Water Management Oversight Committee, with four-year terms ending May 31, 2025. • Two (2) positions on the Utilities Advisory Commission, with three-year terms ending May 31, 2024. Human Relations Commission (Municipal Code Section 2.22) 2.22.010 Membership There is created a human relations commission composed of five members who are not council members, officers or employees of the city, who are residents of the city, and who shall be appointed by the city council. 2.20.060 Authority Upon making a finding pursuant to Section 2.22.050(a), the commission may act as follows: (a) To foster public awareness and understanding of human relations problems by any means of disseminating information including, but not limited to, educational programs and printed and electronic media; (b) To facilitate resolution of problems or improvement of conditions within the jurisdiction of the commission by encouragement, persuasion and mediation and by pointing out private or public agencies which might provide assistance; (c) To make such studies which, in the judgment of the commission, might aid in affecting matters within the jurisdiction of the commission; (d) To recommend local legislation or other action to the council and to encourage the council to support or oppose state or federal legislation or regulation relating to matters within the jurisdiction of the commission; (e) To coordinate programs of the commission with similar programs by private and public agencies and organizations; and (f) To recommend or oppose legislation other than that of the city, provided that the city council has not taken an official position with respect to such legislation, and Page 3 provided further that any communication, whether oral or written, from the commission concerning such legislation clearly indicates that such recommendation or opposition is that of the commission and is not necessarily that of the city council. Public Art Commission (Municipal Code 2.18) 2.18.010 Membership There is created a public art commission composed of five members who are not council members, officers, or employees of the city, and who shall be appointed by the city council. 2.18.070 Jurisdiction (a) Art in Public Places. The public art commission shall perform the duties and shall have the responsibilities specified in Chapter 2.26 of this title. (b) Additional Duties. The public art commission shall perform such other duties and undertake such other responsibilities as the city council may direct from time to time. (c) Interaction with Other City Bodies. If the functions of the public art commission overlap the functions of another city committee, commission, board, task force, or the like, the director of arts and culture, in cooperation with the public art commission and such other city body, shall devise a procedure for coordinating such functions to avoid duplication of efforts, to maximize cooperation between the city bodies, and to u tilize the expertise of the various city bodies in a manner most compatible with the public welfare. (d) Interaction with City Departments. The chief building official shall determine whether a proposed work of art is a mural or a sign under Section 16.20.011(a)(10) of this code prior to review by the public art commission. Storm Water Management Oversight Committee (2017 Ballot Measure) Summary The purpose of the Storm Water Management Oversight Committee is to review proposed storm water management capital improvements and operating programs to be funded from the Storm Water Management Fees and to monitor expenditures of the fund. The Storm Water Management Oversight Committee is charged with reviewing the annual budget and expenditures of the Storm Water Management Fund in order to ensure that revenue from the Storm Water Management Fee is being budgeted and spent in accordance with the terms of the storm water management ballot measure approved by a majority of property owners in 2017. The Committee is responsible for: • Performing an annual review of the proposed Storm Water Management Fund budget • Performing an annual review of actual expenditures from the Storm Water Management Fund • Adopting findings on an annual basis that the proposed budget and actual expenditures of the Storm Water Management Fund are consistent with the spending plan outlined in the 2017 storm water management ballot measure • Reporting findings on an annual basis to the City Council Page 4 The Committee is composed of seven members who are selected and appointed by the City Council for a term of four years. Each Committee member shall be a resident of Palo Alto, an employee of a business located in Palo Alto or an owner of real property within the City. Utilities Advisory Commission (Municipal Code 2.23) 2.23.010 Membership There is created a utilities advisory commission composed of seven members who shall be appointed by and serve at the plea sure of the city council, but who shall not be council members, officers or employees of the city. Each member of the commission shall be a utility customer or the authorized representative of a utility customer. Six members of the commission shall at all times be residents of the city. 2.23.050 Purpose and Duties (a) The purpose of the utilities advisory commission shall be to advise the city council on present and prospective long-range planning and policy and major program and project matters relating to the electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility and recycled water matters, excluding daily operations. (b) The utilities advisory commission shall have the following duties: (1) Advise the city council on long-range planning and policy matters pertaining to: (A) Development of the electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility, and the recycled water resource; (B) Joint action projects with other public or private entities which involve, affect or impact the electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility, and the recycled water resource; (C) Environmental aspects and attributes of the electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility, and the recycled water resource; (D) Water and energy conservation, energy efficiency, and demand side management; and (E) Recycled water matters not otherwise addressed in the preceding subparagraphs (A) through (D); (2) Review and make recommendations to the city council on the consistency with adopted and approved plans, policies, and programs of any major electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility, or the recycled water resource; (3) Formulate and review legislative proposals regarding the electric utility, gas utility, water utility, wastewater collection utility, fiber optics utility and the Page 5 recycled water resource, to which the city is a party, in which the city has an interest, or by which the city may be affected; (4) Review the electric utility, gas utility, water utility, wastewater collection utility, and fiber optics utility capital improvement programs, operating budgets and related reserves, and rates, and the recycled water program, budget, and rate, and thereafter forward any comments and recommendations to the finance committee or its successor; (5) Provide advice upon such other matters as the city council may from time to time assign. The utilities advisory commission shall not have the power or authority to cause the expenditure of city funds or to bind the city to any written, oral or implied contract. (c) The utilities advisory commission may, subject to its city council-approved bylaws and at the discretion of the city council, foster and facilitate engagement with the general public, not excluding representatives of commerce and industry, in regard to the utility matters referred to in subsections (b)(1)(A) through (E). ATTACHMENTS: • Attachment A: Boards and Commission Applications- Spring 2021- HRC, PAC, SWMOC, UAC_Redacted (PDF) Department Head: Beth Minor, City Clerk Page 6 Boards and Commission Applications Spring 2021 Recruitment Human Relations Commission (Three positions with terms ending May 31, 2024) 1. Sunita de Tourreil (Incumbent) 2. Adriana Eberle 3. Michelle Kraus 4. Angeli Patel 5. Kaloma Smith (Incumbent) Public Art Commission (Three positions with terms ending May 31, 2024) 1. Shiraaz Bhabha 2. Loren Gordon (Incumbent) 3. Mette Huberman 4. Ian Klaus (Incumbent) 5. Emily Meyer 6. Ben Miyaji (Incumbent) 7. Cleia Muggler 8. Harriet Stern 9. Lisa Waltuch 10. Mark Weiss Storm Water Management Oversight Committee (Four positions with terms ending May 31, 2025) 1. Stephanie MacDonald 2. Hal Mickelson (Incumbent) 3. Dena Mossar (Incumbent) 4. Catherine Perman 5. Bob Wenzlau (Incumbent) Utilities Advisory Commission (Two positions with terms ending May 31, 2024) 1. John Bowie 2. Carol Guthrie 3. Don Jackson (Incumbent) 4. Phil Metz 5. Rajmohan Rajagopalan +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH sunita@chocolatedividends.org Sunita de Tourreil Sunita de Tourreil Sunita de Tourreil 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ -Commissioner for Human Relations Commission 2020-2021 (replacing Commissioner Lee) -SubCommittee member that reviewed CBDG grants for FY 2021-22 -Hate Crimes Letter to Council 3/2021 -Liaison to PAPD 3/2021- -Liaison to Council Member Khou 3/2021- -Volunteer at Addison Elementary School with Project Cornerstone (social emotional learning) and other activities at Addison and Girls Middle School. -Started attending City Hall Meetings in early 2020. Spoke at one (pre-covid), inquiring about a police incident that I observed. -Trained as a CASA (Court Appointed Special Advocate) in 2005-2006. -Multiple community events through my social enterprise, around educating around supply chains, around using your purchasing choices to bring about change in the world. Sunita de Tourreil MASTERS of SCIENCE, MOLECULAR BIOLOGY AND HUMAN GENETICS Worked at UCSF with dying patients with Creutzfeldt Jakob disease, collaborating with nurses, orderlies, local businesses, doctors, scientists all working together to develop a diagnostic test. Founded and built a business that built diverse community in Palo Alto between 2010 and 2018 (The Chocolate Garage) and addressed bringing transparency, accountability and activism to the cocoa supply chain. Also lead luxury educational trips to the global south, to educate and open minds towards other cultures. Single mom to two kids going to school in Palo Alto. Happy Chocolate Experiences, LLC ✔ Entrepreneur, Travel Expert, Chocolate Expert ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ I am interested in seeing more transparency and accountability around diversity, so that we include more voices, and more compassion in our city policies. I am interested in this as a biracial cisgender woman raising two white identified kids, as a single mom in a culture of white male supremacy. My white kids voices will likely be more listened to, and heard, than their black and brown friends and family members. In addition to raising them to understand their white privilege and then be moved to use that privilege to help protect and give voices to those who aren't being listened to, I want to take part in our local community, as a minority biracial resident of Palo Alto. I have benefited from much of the privilege that is bestowed upon affluent white families, having immigrant parents with graduate degrees and growing up in Canada and getting a graduate degree. I want to be aware of this privilege and use my skills to listen to those who have less voice. I also want to use my immigrant experience to bring a fresh look at our cultural short sightedness and broaden the conversations we are having and the solutions we are considering. Sunita de Tourreil As a non-voting immigrant, I want to take part in civic discussions. I wish to continue to be engaged in my local community, beyond the community building that I did while operating a local curated boutique and tasting room. When Commissioner Lee ran for City Council, and a position opened up, I thought I would see what the position requires and whether it would allow me to bring my skills and experience to the table. My experience working with people, both in a medical setting as well as in a retail setting, and internationally guiding folks through travel experiences in the global south, has made me a very good listener, as well as a good question asker. I have scientific training and a logical mind that can process data and see patterns and understand tricky problems. My empathic focus also means I understand how to bring my heart to the table as well, and work to create community that is warm, welcoming and inclusive for all. I bring the additional perspective of being a citizen to two other countries (Canada and Switzerland), arguably with higher quality of life and stronger community fabric. I also speak English, French and Spanish. My travels as a child and as an adult make me a chameleon, able to fit into multiple kinds of environments. I can move between the communities with the fewest resources in Palo Alto and the communities of greatest affluence, bringing an authentic presence to both, perhaps the perfect marriage of my Swiss dad and South Indian mom. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW n/a Sunita de Tourreil I would really like to see the HRC build bridges between the Palo Alto community, and the city government: ie. City Council, City Staff, various commissions and Police and Fire Department. I think that our local community and city government would benefit from more engagement, more awareness, more empathy and understanding of each other, and that together we can build a stronger, more engaged and compassionate Palo Alto. I believe more community engagement, and awareness raising around racial equity, as well as the plight of vehicle dwellers struggling to find permanent housing in one of the most expensive cities in the country, will go a long way to finding a broader willingness for our community to engage in meaningful ways, and be part of the solution. I think Palo Alto can take a more honest look at its history and where it has failed to be better, and strive to make amends and repair the harm of decades of systemic policies that have kept Palo Alto lagging not leading. I think that finding ways to inspire and educate our community, helping folks soften their hearts and nurture empathy, to understand the human stories behind our marginalized communities, will go a long way to transforming Palo Alto into a city where people of all socioeconomic and racial groups feel a sense of belonging. We have already raised awareness with the Chair and Vice Chair's work documenting black and brown stories in our communities. Now we must keep the community conversations going and continue to raise awareness, inspiring our members to get more engaged. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 04/06/2021 Sunita de Tourreil Sunita de Tourreil +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH liederseberle@gmail.com Adriana Lieders Eberle Adriana Lieders Eberle 688 Main St. Redwood City, CA 94063 adriana@eberlaw.com 650-461-9066 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+LVWRULF5HVRXUFHV%RDUG" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ Community Legal Services in East Palo Alto (2014-2015) provided legal advice and counseled clients facing eviction. Ohlone Elementary School: Co-Chair of the school's biennial auction (2017 and 2019) - Organized a live and silent auction. Site Council (August 2012 – May 2014)- Member of a three person team that designed and implemented a climate survey to the school’s staff, parents, and students. Parent Teacher Association (PTA) Executive Board (Historian- August 2013 – May 2015)- Liaison to several sub-committees including special education. Chair of the PTA Nominating Committee (February 2014 – May 2014) - Responsible for identifying and recruiting volunteers for key leadership roles. PAUSD: Member of PiE (2019-2020) JLS Middle School: Member of the Connections Board (June 2020- Present) Palo Alto High School: Co-lead of the Class of 2024 Parent Network (August 2020- Present) Parents Nursery School, Palo Alto, CA - School co-president for the 2012-2013 school year. Adriana Lieders Eberle Instagram Post The Law Offices of Adriana L. Eberle (December 2015- Present): Member of the Private Defender Panel in San Mateo County. The San Mateo County Private Defender Program is the sole provider of indigent defense in San Mateo County. Deputy District Attorney positions: Office of the District Attorney in San Mateo County (Volunteer, August 2015 to December 2015) Office of the Commonwealth's Attorney in Loudoun County, VA (April 2005- June 2010) Office of the Commonwealth's Attorney in Fairfax County, VA (January 2002- April 2005) Georgetown University Law Center (J.D. 2001) and Syracuse University (B.A. 1998) Self-Employed Owner - The Law Offices of Adriana L. Eberle ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ As a former prosecutor and presently, a criminal defense attorney, I am very interested in police brutality and systemic racism in policing. Last Spring the Commission tackled the issue of police brutality as thousands of protesters took to the streets of Palo Alto to demonstrate against the police. Calls to defund the police were heard all across the country. Based on community input the Commission acted swiftly and made several recommendations to City Council regarding police funding, hiring, and policies. As a witness to systemic racism in the criminal justice system, be it the police, probation officers, zealous prosecutors, or judges, I have strong insight into this system. I have worked on both sides and have an in-depth knowledge of its inner workings and how to affect change. I have a life long interest in these issues and would love the opportunity to utilize my knowledge in order to make this a more just city. Adriana Lieders Eberle First and foremost I would like to serve on the Human Relations Commission because I love Palo Alto. My family and I moved to California in August 2010 and quickly realized we wanted to relocate to Palo Alto, and so we did, in January 2011. Growing up in Brazil and living in several cities on the East Coast has given me an unique perspective as to the challenges facing Palo Alto and what its strengths and weaknesses are. I have two children in the school district, a 6th grader and 9th grader who have gone through the Palo Alto public school system. I have been a stay-at-home mother and a working mother. I have been a renter in Palo Alto, and now a home owner. Personally I would bring to the commission a diverse background with deep ties to this community. Professionally I have been a prosecutor and now a defense attorney who specializes in indigent defense. I have extensive experience in speaking with and defending people of all backgrounds, including the most vulnerable. People who have been systemically discriminated against and who have absolutely nobody to support them. I also have experience training and working with police officers, community advocates, and crime victims. As I have been on both sides of the justice system I would bring a balanced and analytical approach to the Board. Because of my profession as a lawyer I also bring to the table a deep understanding of legal policy and procedure. I have extensive experience analyzing statues and municipal codes and applying them. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW Although I don't have personal experience with these documents besides reading them, I was previously made aware of the landlord-tenant dispute resolution process through one of my friend's experiences with her landlord. Adriana Lieders Eberle The Covid pandemic has been a rude awakening to the city. One doesn't need to spend much time on social media to see that the city is suffering and its citizens are deeply divided. I am extremely concerned about Palo Alto's future. The rate of hate crimes is on the rise in Palo Alto and across the country. I understand that the Commission has started working on this issue, and I applaud them for that. I believe that my background would be helpful in understanding the law, analyzing it and offering guidance to the City. Given my profession I am also experienced in engaging with people from all walks of life and look forward to putting my skills to good use as a member of the Commission. The Pandemic has also exacerbated some issues that have been simmering all along - social and economic inequality, housing, and racial justice. I would like to see the commission tackle these issues head on. What kind of city do we envision Palo Alto to be 20-30 years from now? Palo Alto is the birthplace of Silicon Valley and a hub of innovation, we should bring cutting edge and innovative strategies to City Council. The post-pandemic roadmap will be unlike anything we have witnessed within our lifetimes. Let's take this opportunity to create a city that doesn't only talk about issues but actually implements change for the betterment of all its citizens. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 04/05/201 Adriana Lieders Eberle Adriana L. Eberle +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH michellekraus@yahoo.com Michelle Kraus, PhD Michelle Kraus, PhD PO BOX 116, Palo Alto, CA 94302 650-218-5540 michellekraus@yahoo.com 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ Involvement in Affordable Housing, Rent Control issues, Clean Tech as a volunteer and long term renter (since arrival in PA in 1998 excluding period in Menlo Park) Co-founded early Clean Tech Company dedicated to the work on pricing carbon. Spoke in the community and wrote articles that were published nationally. I have participated/developed/managed grassroots political activities at the local, regional and national level since 2002. I have coordinated events on progressive issues, grassroots fundraisers and national issues -- women, AAPI, and other special and ethnic issues as a national co-chair of John Kerry for President; as a Finance Committee member of Hillary for President; as Member of the National Fundraising Committee for Obama for President; and as a Founding Member of Biden for President’s Innovation Committee, Women’s Group and the National Finance Committee. Helped to found, run and serve on the community-wide Blue Ribbon Climate Task Force for Menlo Park (1998 to 2008) Helped to re-establish the AAPI community in the Democratic Party (community wide and national 2002 thru 2005).Participated and often led community-wide events. Overall, I’ve worked on women’s issues in the workforce all of my adult life.പ Michelle Kraus, PhD BA and MA in American Culture (study of cultural and sociological trends in the US) Certificate for Women's Studies (one of the first granted at Douglass College, Rutgers University) Studies at Eagleton Institute, Douglass College (study of women, trends, and policies) Writings published in the Huffington Post on politics, policy for over a decade. Writings published in Forest and Trees (a leading Progressive blog) on progressive politics Overall, working with many women, social causes and climate change organizations over the decades. Technology & Politics ✔ Tech Exec, Expert, and Crisis Consultant ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ The issue of hate crimes was discussed in the February and March meetings. There were disputes among the Commissioners, and perhaps some resolutions because of urgency. I suggest that the Commission draft (if they have not already done so) a public statement to be adopted by the Palo Alto City Council from which city-wide policies flow. This should be the umbrella policy statement under which the City operates. It is important to make this public as community-wide talking sessions are developed to coordinate actions. This is not a time to defer or be silent. Hate and hate speak must be removed, and citizens need to see the City has a Commission that is taking action. 1. Improve the messaging and communication vehicles on specific policies and tactics taken concerning prejudice and hate in the City of Palo Alto. I have a life-long commitment to social change having grown up in an ethnically and racially diverse small town outside of New York City -- in the shadow of the race riots of the 1960's watching as neighborhoods in Newark, New Jersey was burned down to the ground. The bridges were turned to stop the rioters from accessing the white working and middle class towns -- not very different during the Rodney King race riots when I lived in Santa Monica, California though in California we were closer and heard the shots and the sirens. These life experiences often change people for the good, and sometimes for the bad. For me, it helped shape my activism to change the system. For me, it was a pathway of study, understanding and activism. I've written, I've lectured, I’ve researched, I've spoken and I've helped form new groups to affect change. This is basket full of tools that I will bring to the Human Relations Committee and a hunger to get things done. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW 1. Improve the messaging and communication vehicles on specific policies and tactics taken concerning prejudice and hate in the City of Palo Alto. 2. Develop community-based 'talking sessions,' and offer training on the methodologies of engagement to open up discussion. I know that this is a very engaged populace, yet it leaves many out of the discussion. 3. Continue the work on affordable housing, rent control and rent abatement. 4. Review the work already done on health care equity. Public health care and policies are critical at this point in time. 5. Continue to coordinate with the County. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Michelle Kraus, PhD Michelle Kraus +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH n/a Angeli Patel Angeli Patel 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+LVWRULF5HVRXUFHV%RDUG" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ --Constitutional Police Reform (11/2020-Present): Ongoing legal research and advice about police reform to LAPD through law firm pro bono project; previous research include reforming Stop policies and diversifying community outreach programs. --The Warmth Project (11/2020-1/2021): Founder; Provided 120 warm mac n' cheese and chicken wings meals to the unhoused community in Oakland for the holidays by raising money through social media. --Let's Talk (6/2020-7/2020): Organized 100+ South Asian people online of different ages to discuss ant-blackness and racism in the community in the wake of the BLM protests; see https://bit.ly/3wfLkRO. --Bet Tzedek Unemployment Law Pro Bono (4/2020-5/2020): Provided pro bono legal advice to LA residents in the wake of unemployment crisis during COVID-19. --Berkeley Small Business Pro Bono program (3/2020-5/2020): Provided small businesses legal advice pertaining to PPP loans and how to navigate government resources for COVID-19 relief. --Agents of Change (8/2018-6/2019; Board member): non-profit empowering high school students to engage in civic activism; helped incorporate the non-profit. Angeli Patel California Bar Association South Asian Bar Association J.D. UC Berkeley School of Law B.S. International Affairs, Georgia Institute of Technology Jones Day ✔ Attorney ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ I was fascinated by the 8CantWait discussion because it aligns well with my recent organizing efforts and my work at the law firm. When I mentioned that all change is local, this priority area is where it is most applicable. Many cities are struggling to make necessary changes on police reform and the broader context of engaging the community on difficult topics like racism and hate. I have been working with Vice Chair Stinger to train 100 leaders for anti-racism and developing a discussion guide for it. This topic is important to me because racism and hate has started to tear relationships apart. Without government and community leadership, I worry that it will only get worse. 8Can'tWait is a great start to creating a safer community for people of color. But more can be done to address racism in Palo Alto. With my experience organizing communities, I know that engagement is 75% of work towards inclusion. Getting people to engage with their city and neighbors activates awareness. I would work with the HRC to develop a robust engagement strategy on this topic that meets Palo Alto residents where they're at. Angeli Patel I am inspired by the Human Relations Commission (HRC) because I am a product of a strong community myself. Growing up in rural Georgia in a poor family, I relied on having a strong community that cared to invest in me. From teachers that cared about what was happening at home to businesses that opened their doors for a job-- a strong community meant that each person was engaged in your wellbeing. I want to join HRC because it has the power to set the ethos of our community and keep it strong, especially in these trying times. ALL changes starts local and urgent. That is why I want to get involved now. My experience helping the HRC organize discussions about racism in the community, organizing the South Asian community remotely across various cities, and being on the ground providing meals to the houseless community among other listed above, have prepared me to serve. Each experience highlights my ability organize myself, my thoughts and people around a mission. It also means I can put my head down and do the work of writing and project managing. In addition, as a lawyer, I stay engaged in matters that are relevant to the community through the pro bono practice. Finally, I have served on two boards for non-profits which has taught me how to make the most impact with the least funding. Finally, I have a background in design and social media which have made it easy to scale community projects. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW I do not have experience with these documents specifically, but I have experience navigating municipal codes and city regulations. I have also partially read through the Human Services section of the Comprehensive Plan. On a side note, I wanted to mention that I believe any group is only as effective as the team members who are a part of it. I have always valued working cohesively, getting to know different opinions and creating spaces where differences are an asset to executing a vision. If selected to serve, I will bring a mindset of collaboration first. It is a core value for me to be efficient and harmonious. Under the leadership of the Chair, I believe my listening-first and open personality can be an asset to the Commission. Angeli Patel Organizationally, develop an achievable plan for each issue priority identified in the Jan and Feb meetings and post it online (or share internally). This would help the HRC be transparent and have something to work towards; Reserve 5 minutes on the agenda for a creativity brainstorm that could be open to the public; meet each Commission member for one-on-one coffee to build bonds within the Commission. For anti-racism, help train 100 leaders on anti-racism and learn from it to develop a recurring training on anti-racism that local leaders, small business owners, and individuals can take and get a "HRC Trained" certificate. Create a model "truth and reconciliation" mediation guide to be made available to the public as the first of its kind in the nation to address the hate crimes happening around the city. I can draft, research, and find experts to inform both processes. For efficiency, instead of only HRC taking on solving complex community problems, we could host a Silicon Valley-style incubator for community members to participate and pitch their solution (similar to a pitch competition but a social hackathon). I can organize. Idealistically, connect small businesses and unemployed people. I would organize a small business hiring fair that can be replicated yearly to help fill vacancies and get people jobs. This would be subject the HRC's priorities. I could also start a "Humans of New York" style monthly short blog that highlights a quick quote from a random community member and share it on social media/website. This would engage people more to the HRC and each other. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Angeli Patel Angeli Patel ANGELI PATEL 734 Webster Street, Apt. C • Palo Alto, CA 94301 • (478) 484-1762 • angelip92@gmail.com EDUCATION University of California, Berkeley, School of Law, Berkeley, CA Degree: J.D., May 2020 Activities: Women and Tech Law (Board Member); Berkeley Technology Law Journal (Editor); Berkeley Information Privacy Law Association (Vice President); Prisoner’s Advocacy Network Bar Status: California, 2020 Georgia Institute of Technology, Atlanta, GA Degree: B.S., International Affairs, May 2014 (focus on cybersecurity and European Union) Honors: Ivan Allen Jr. Legacy Award (for leading social change and achieving excellence in international studies); Woodrow Wilson School Fellow, Princeton University (for foreign relations, technology and counter-terrorism); National Science Foundation Scholar for Service (for cybersecurity and government critical infrastructure). Activities: Founder of Rethink Disabilities Awareness EXPERIENCE Jones Day – Palo Alto, CA November 2020 – Present Associate Experienced in corporate and energy law. Drafting, research and reviewing hundreds of pages of contracts and documents to aid in corporate transactions as well as litigation. Involved in the Constitutional Police Reform project to aid LAPD in their policy reform. Summer Associate May 2019 – August 2019 Analyzed and wrote a brief for the significance of excluding choice of law provisions in contracts. Synthesized feedback from partners and clients to incorporate legal strategy into the work product. Presented research on dual-class stock structures to the all Jones Day corporate attorneys in the Northern California region. Trained in groups for depositions and negotiations strategy. Aided in filing for NYSE disclosures for foreign private issuers and updates to 10-K for publicly listed clients. UN Global Compact Network Australia – Melbourne, Australia September 2019 – December 2019 Associate Helped identify strategic opportunities to engage with government, private companies, civil society and community stakeholders. Gathered external feedback from and documented engagement strategies with industry players, experts, academics, advocacy groups, think tanks, and governmental and civil society. Wrote proposals to the Senate on labor, sustainability and climate change policy. Wrote briefs, talking points and concept notes for corporate executives and government leaders for the National Dialogues on Anti-Corruptions and Bribery and Business and Human Rights. Drafting a short paper on the role of stock exchanges and self-regulating organizations under the stakeholder primacy model. Synopsys – Mountain View, CA May 2018 – August 2018 Legal Intern $3 billion electric Design automation company. Assisted with the due diligence review of documents in M&A transactions. Assisted in drafting memorandums and analyses relating to IP law and corporate governance issues. Researched new regulations and changes to legislation, and collected precedents and assisted with transaction management. Government of Chile – Ministry of Finance – Santiago, Chile May 2017 – August 2017 Policy Advisor Presented policy proposal to Ministry leadership to fund user satisfaction research, which led to the creation of an office dedicated to user satisfaction research. Persuaded leadership to send diplomats to the UK to learn more about Open Data portals and how the Chilean government can benefit from international examples. Drafted memoranda to agency leadership on topics such as open data, fiscal transparency, user experience, public trust and digital government. The White House – Office of Management and Budget – Washington, D.C. December 2015 – January 2017 Chief of Staff Served as proxy for the Deputy Director when interfacing with high-level stakeholders in industry, labor and Congress. Developed tools and metrics for measuring the impact of internal engagement in our organizational structure. Managed 300 employees in a fast-paced environment focused on drafting $3.6 trillion U.S. Budget for Congressional approval. Synthesized results from stakeholder engagement and incorporated critical outside perspectives to inform our policy. Advised Deputy Director for Management on policy including government contracting, cybersecurity, open data, privacy, and hiring practices. Wrote talking points and memorandums for White House leadership explaining policy progress and implications. Communications Intern May 2014 – August 2014 Vetted organizations and individuals meeting with the President using agency-specific and public databases. Researched and compiled information on counterterrorism efforts, immigration reform, and international nuclear nonproliferation activities. Monitored full-time media 12 hours a day for the White House, alerting aides of media response to the President’s daily activities. U.S. Department of Health and Human Services – Office of the Chief Privacy Officer March 2015 – December 2015 Privacy and Security Policy Analyst – Washington, D.C. Managed project with 6 U.S. Governors and other state level stakeholders to produce a state-wide strategy for health data interoperability. Gathered external feedback from Governors of each state and documented engagement strategies and guided the development of state-level interoperability roadmaps. Led team of 10 to create a long-term strategy to reduce public perception of privacy/security as a barrier to interoperable exchange of health data. ADDITIONAL INFORMATION Languages: Gujarati & Hindi (Native), Urdu (Speaking), Spanish (Beginner) Interests: Travel (26 countries), fiction book club, event planning, Bollywood Hip Hop, vegan cooking Skills: Writing, digital design, public speaking, PowerPoint presentations, stakeholder management, social media engagement Publications: Magic in the Shower (See Also Literary Journal at Berkeley Law); Google: Do no evil or do the right thing? (Berkeley Business in Society Institute Corporate Sustainability Blog) +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Kaloma A. Smith Kaloma A. Smith 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ See attached Kaloma A. Smith I currently serve on the commission See attached University AME Zion Church Pastor 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ See attached See attached 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW See attached See attached 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Kaloma A. Smith Kaloma A. Smith List relevant education, training, experience, certificates of training, licenses, or professional registration: I have a wide range of experience and training that I feel would make me very useful in the role. Here is a brief synopsis of relevant leadership experiences: 1.I have successfully led the HRC as the chair in a challenging time. Under my leadership, we have addressed Policing, Housing, Race, and Hate crimes in significant ways. 2.I have successfully led the University A.M.E. Zion Church through a significant transformation and growth. When I arrived five years ago, our congregation was down to 19 active members, black and seniors. Today we have grown to 250 active participants, and we are now a multicultural church with an average age of 32. 3.I have completed the required course of study and educational training necessary for the African Methodist Episcopal Zion Church's ordination. The ordination criteria are eight years of denominational research and formal schooling. This training included a focus on community building, interpersonal conflict resolution, and more. 4.Currently enrolled in a Master of Divinity at Wesley Seminary. 5.I have been selected to be part of the Next Generation Leadership Cohort of World Methodist Evangelism is part of the World Methodist Council, which represent 82 million people from 133 countries. 6.I serve on the board of Manzanita Works 7.I received the Supervisor Award from the County of Santa Clara in February 2020 for my work in Social Justice Describe your involvement in community activities, volunteer and civic organizations: I am currently the Senior Pastor of the University A.M.E. Zion Church, the oldest black church in the city of Palo Alto; this role has allowed me to connect with a wide range of community leaders to be at the forefront of community dialogue around many issues. In the past eight years, I have led or participated in several initiatives in our community: Covid Vaccination Site: University is currently one of the few COVID vaccination sites in North County. We vaccinated 370 individuals on the first day and planned to try and vaccinate more than 1000 individuals on our next date. Community Open Forums on Race in America: After the tragic shootings at Mother Emmanuel A.M.E. Church in Charleston, SC, there was a significant community outpouring of concern about race and where we move from here. We held several community forums, which each had over 150 people in attendance. These forums allowed us to discuss race and equality in our community and our country as a whole. We executed three significant initiatives out of these community forums; the first was the Community Unity Fair at Cubberley Community Center. We partnered with the city of Palo Alto and several local religious and civic organizations to hold a community fair that had children of different racial, ethnic, and religious backgrounds coming together to have fun. The goal was to create a space that would allow children to meet others from different backgrounds and let them see that we are all the same. The second was viewing and discussing the movie. Church. This movie dealt with white privilege and its impact on racism and implicit bias and how it impacts Palo Alto. The discussion was lively and cathartic. The third activity was a community book club that read the book "The New Jim Crow." It was a thought-provoking and compelling dialogue dealing with mass incarceration and how it impacts our communities. I have also partnered with the Human Relations Committee to plan two initiatives in 2016 and 2017 named "Being Different Together." The original 2016 was a panel discussion and forum held at the Mitchell Park Library. I was part of the planning team, along with being the moderator for that event. This event was a great success and well attended; it sparked us to ask how we could continue the positive momentum and equip community leaders with tools to address implicit bias? In 2017 we planned a 4 part Being Different Together." We worked with Dr. Joseph Brown from Stanford University to bring the implicit bias training that Stanford developed to the Palo Alto community. We were intentionally inviting and encouraged persons from varied perspectives to be part of this community dialogue. It was terrific to have so many different views in the room. It made the discussion more meaningful and authentic. This initiative was a great success because of the positive community response. It also allowed people to reflect their implicit bias, and it equipped them with tools to take back to their various constituencies. I have also been active in promoting and developing ecumenical and interfaith connections in Palo Alto. Under my leadership, the University A.M.E. Zion Church has led our community in several activities to encourage religious tolerance. One of our events was sponsoring the 2016 Multifaith Peace Walk and Picnic to remember 9/11. The Multifaith Peace Walk started at Congregation Etz Chayim/Spark Church. It went to University Church, followed by walking to Our Lady of the Rosary Catholic Church, and concluded with American Muslim Voice hosted Peace Picnic at Mitchell Park. Each of the stops put together a brief presentation on how we can achieve peace in our society. The march was a fantastic show of solidarity in our community with over 700 participants and over 35 community faith and civic organization represented, including the Chief of Police from the city of Palo Alto. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? Building healthy and sustainable communities is one of my passions. Whether it is in my role as Senior Pastor at University or in the Palo Alto community, I desire to build bridges and give all stakeholders a voice equitably and efficiently. I believe this lines up with the stated purpose of the Human Relations Commission of fostering public awareness and understanding of human relations by any means. I believe the first step in any movement forward or reconciliation is an open dialogue, and it will foster compassion and communication for all parties involved. We live in tough times, and I believe for Palo Alto to be a healthy and dynamic city, the work of the Human Relations Commission is vital. People in the community need to know a place where they can speak on complicated and nuanced issues we face today. I believe this more today than when I started my first term on the HRC Please describe an issue that recently came before the Commission that is of particular interest and explains why you are interested in it? I am highly interested in all the items on the current work plan for the HRC. I believe that each of the three elements of Equity and Belonging, Homelessness and Housing Insecurity and Mental Health and Wellness are critical areas we need to focus on moving forward. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? Please see the current HRC work plan. Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursdays of the month at 7:00 P.M......... Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Public Art Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Shiraaz Bhabha Shiraaz Bhabha shiraaz@shiraaz.com I would love to see Public Art as the centerpiece in our community where the city provides a backdrop to all the changing artwork and projects. The art can be visual, like images, sculpture and installations or interactive to include and engage the viewer. It is exciting to expand to other mediums like digital media, performance art and literature exhibits (poetry, storytelling, etc.). I would also engage and collaborate with neighboring communities, as it is a great way to foster connection within the art collective and create a wider, more inclusive community as well as encourage more art all over the Bay Area. With the success of locally headquartered companies, I think there is an opportunity to augment city funding with corporate contributions to Public Art. I think art has a potential to bring attention to social justice and environmental issues. It can help us see a different perspective, gain new knowledge or initiate discussions to understand and empathize with other viewpoints. Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Public Art Commission How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Program manager, Volunteer artist and Fundraiser for the Kids & Art Foundation. Managed and coordinated the Lucile Packard Children's Hospital workshops and the Indigogo fundraising campaign that raised over $25,000. Also volunteered as an artist at the workshops. Motivated by a shortage of preschool openings, I co-founded Slippery Fish, a cooperative preschool, with 3 partners to provide social engagement and learning opportunities for a group of neighborhood children. Slippery Fish is now a First Five San Francisco Excellence Award winning cooperative preschool. Volunteered at Palo Verde elementary school (noon art, room parent, event organization like book fairs, etc.). Artist for the Palo Alto BLM mural in 2020. Currently a Microgrants Selection Panelist for the Palo Alto ArtLift Microgranting Project. Shiraaz Bhabha - BFA in Commercial Art - MFA in Computer Art - Painter/Artist - Graphic artist and user experience designer for multiple silicon valley companies - Freelance photographer - Spectra art teacher at PAUSD PAUSD 4 Spectra Art Teacher 4 Page 3 Public Art Commission 2.Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) 1.Why are you interested in serving on the Public Art Commission and what experience would you bring to the position? (1518 characters) Public Art Commission March 18th, 2021 https://www.youtube.com/watch?v=EJ2mwbY3sL0&t=5s I have a particular interest in the initiative of the Arts Commission and the Human Relations Commission to create a permanent platform for temporary art that focuses on promoting diversity and racial justice. Having this platform can create opportunities to raise and promote awareness on various issues we face today as a society. The temporary nature will allow us to cover a variety of important topics. The permanent platform will keep a focus on these issues. We can highlight several issues such as racism, gender injustice, refugee crisis, income inequality, gun violence, ageism, human rights, etc. Being an immigrant American myself and given all the recent events, I have been thinking about this initiative a lot recently. I am excited to see the commission taking action on this already and would love to contribute to it. Participating in the Microgrants Selection Panel and working as an artist on the BLM mural helped me realize the amazing things being done with the arts in our community. I believe Public Art can become the community nucleus that brings people together by engaging and involving them, while making our neighborhood more vibrant and beautiful. It humanizes the built environment and enhances public spaces. It adds meaning to our city and uniqueness to our community. It also creates important conversations and builds a stronger community, especially during this time, when there are so many polarizing opinions. As a Palo Alto resident who is passionate about this community, I would love to bring more art into the public space, and create memorable experiences for everyone. I would advocate and involve people of all ages, from the youth to seniors. I want to increase engagement through outreach in schools, senior communities, local social media groups, art organizations, city departments and the like. I think the commission's excellent work in involving local business and community organizations has been very effective and should be continued. I have spent most of my life around art, from painting, digital art to photography. I started teaching art at our local elementary school a couple of years ago. I intrinsically understand the importance of art - creating it, encouraging it, fostering it, and being surrounded by it. Page 4 Public Art Commission 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan 3.If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) I do not have any prior experience with this document. However I have studied the document carefully and that has got me even more excited about the opportunity to work with the commission and help make a difference. I would love to see Public Art as the centerpiece in our community where the city provides a backdrop to all the changing artwork and projects. The art can be visual, like images, sculpture and installations or interactive to include and engage the viewer. It is exciting to expand to other mediums like digital media, performance art and literature exhibits (poetry, storytelling, etc.). I would also engage and collaborate with neighboring communities, as it is a great way to foster connection within the art collective and create a wider, more inclusive community as well as encourage more art all over the Bay Area. With the success of locally headquartered companies, I think there is an opportunity to augment city funding with corporate contributions to Public Art. I think art has a potential to bring attention to social justice and environmental issues. It can help us see a different perspective, gain new knowledge or initiate discussions to understand and empathize with other viewpoints. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Public Art Commission 5.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No April 5 2021 Shiraaz Bhabha Shiraaz Bhabha 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Loren K Gordon Loren K Gordon 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 5 "'" +%'" &&"!%3 +%%!'/-"%-'!"'%%'" &&"!%!' + !("!&" &&"!'"'%" +!'/!#+'"%!%(&'%&!/%&+(!!' %("!!!&'("!"!%'-"%"+&"!%2$+'/!!+&"!"! ! 04 , &"!!,",-''+(&"'" &&"!!+!%(&'&("!2-"%!"!&'"% ' +%2%,-!'!-&'%'#!"%"%!,!+2!"'%.(!#%"'& !&+##"%'"#+%'4 5"/&!%&+"' !!&+3#-'""#%#%("!!&'%+("!4 5"+!'%-'$+.!'"%!%%#%"+'&'" %'!"%%'"!&+%'' & % %&%,%!" 4&"!+&#%" "(!!&!%'%#%"+'&4 5%,"!'.+(," *"+ !'&'"!/4&!,",&!! "+%" +!'/!'#%"% &"2!+!%&!"%'!/4 5 !!&+%+(("!%, %3% ",'%&%" #+%&2#!' !!"+&#!'&2%"%#!'%&!!"%""&4 Loren K Gordon !$ &''+/./&!$ &''',*** ! & !! # $ '! # ! "$ &,*+-(,*+.' & $! ' 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV ""'!'#!##'!#")"##('# '##'-!"""-"-'$##(!#! '!"##"!!!"##!*!-'"#!!. #'!#""!#*!! '#*"'##+#.# ('##'!"""!&!'"!$"#"!$"#"!- !#"'!(*!$"#".!(#"'!(*!"'#"!##)(* !#'$"#!( '#*""#'!#!!.#!"#! )#!'!!$"#"-)###!!#"*!"- #!"#*(!"!$"#"!#*!*. ""!### '")("#"#!#)! +.")## ("&! '!-)!"""#!#!!#)!$"#"#*.(! ###!"#'"#)*#!'## '!$"#". !'%&'!"!(!+!'-"%"'+%'" &&"!!""%("!-'' + !("!&" &&"!4 '/"+!&&'+%'" &&"!'","# #% !!'%'-"%"+&"!%2$+'/!!+&"!"!!0''/4!"%%'" *%+!%&'!"-#"#-",2-"%!,&'"'""+'"!!!'&'/2 '&%('"-"%-''4 .#%!,!/""%(!-'' -!''&#%"'4 -&"!'" &&"!-!'+%' &'%!-&%'2! "%%!'/' ,&'%'+%'!4 .''""!(!+-"%!"!' # !'("!"'& #!&4!. #-"+'%" !("!'"#%'-"%&!',%'' !!-/!!!'#&'%!.#%!4 +%&,!"%'&#+%#"&4 '"+%!!+%'%'- '#%"%'/'"&+##"%'"'"5&&'"%%"!'&!" % "%%"%&-'' #&&"!" +!'/%("!%" ' %&&'"#&+##"%'" '"+&!&&,''/!#&'%!'%4 " &&"!&#%"+'"&+##"%''#" !((,!'"#/"%(&'&4 "3 8&/'"##!-'!'!.''%/%&4-"%-''" &&"!! &''"+!%&2'%'2&&&'%(&'&2!!'%'-''#+"%"3%'7!86794 %!'&.#%!'""3 84 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV & "!! ! ""!&" &"),(!"& #! ") "& & " "+("("('!("(", & "!" ! "&,!) ( " ("" " "" " "&" )!(!&! -)-!( , !" !( !) ("& '!&!. !' )( , ",.! ( (""& &!&& "!"#,'!% & & #(") ""!," "#!"(") ""!!!"! ")"!" , Honestly, the eight murals recently installed in support of Uplift Local have given so many people joy. How can someone walk by Damon Belanger's "California Avenue Marching Band" without smiling? Our goal to get people off computer screens and outside to discover art has made a positive impact. In addition, the micro grant program has connected many people with non- traditional art. I would encourage the commission to continue these positive projects which support the businesses and people of the City. As mentioned earlier in this application, I am part of an ad hoc committee with members from both the Public Art Commission and the Human Relations Commission. We are working together to learn more about the people who live, work and visit Palo Alto in order to hire artists to create an artwork for King Plaza. This goal will be completed over the next year. Successfully hosting Code: ART2. This festival will bring art exhibits to outdoor spaces downtown. The first Code: ART was a success hosting a variety of urban interventions that invited interaction. I look forward to fundraising, selecting artists and working with guests during Code: ART2. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R Loren K Gordon 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Mette Huberman Mette Huberman 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU *For more than 20 years, I have sung as a Second Soprano in the Stanford Symphonic Chorus, performing concerts at Stanford Memorial Church and at Bing Concert Hall every quarter and learning more than 80 different choral pieces. *I am a Stanford Alumni member and have taken six Stanford continuing education courses in art history. *At City College in San Francisco, I have taken courses in weaving and tapestry. I have also taken courses in weaving with local weavers in Palo Alto and Redwood City. *I have attended numerous art history lectures at Stanford Art Department and at local museums. *I am a member of the Legion of Honor and de Young museums. *For the past two years, I have served as Secretary in my Home Owners Association (HOA). Mette Huberman * I have two Master degrees: one in Education Research from Stanford University and one in Education Psychology from Aarhus University in Denmark. I am also two-thirds done with a third Master degree in Art History at the Academy of Art University in San Francisco. In addition, I have taken six college-level classes in art history at UC Berkeley Extension and at Cañada College. *I worked for almost 25 years at a non-profit research company, the American Institutes for Research (AIR). As a Senior Research Analyst, I directed projects evaluating educational programs, including local school arts education programs. American Institutes for Research (AIR), Palo Alto ✔ Senior Research Analyst ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV I find the Public Art Plan for the California Avenue district very interesting because it seeks to strengthen and bring together a whole business district around public art, including businesses, residents, local artists, and visitors. I also appreciate that the project is being carried out in partnership with Barbara Goldstein & Associates, a woman-led, public art planning and consulting firm. One of their projects, Womanhood, seeks ways to honor women s historic contributions to our region and beyond. The issue of female recognition and appreciation is an issue dear to my heart. In my art history scholarship, I am focusing on female artist recognition and appreciation historically. Mette Huberman I care deeply about public art. I believe that public art improves a local community and reflects the people and values of the community. Public art can also bring together a diverse community around common goals of beautification, sustainability, and diversity, in particular after a pandemic. I am an Art History Scholar and have taken numerous courses in art history and art production. I have worked for more than 20 years as a Senior Research Analyst at a non-profit company directing projects to evaluate educational programs, including school arts education programs. I have expertise in all aspects of an evaluation project, from managing people and budgets, to interviewing and surveying stakeholders, analyzing data, and summarizing and presenting data. These skills, as well as my deep knowledge of art history and art, will be very useful as a member of the Public Art Commission. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Apart from skimming the City of Palo Alto Public Art Master Plan, I do not have experience with the document but I appreciate its comprehensiveness, in particular the focus on Goals and Recommendations such as environmental projects and educational initiatives. If selected to the Public Art Commission, I look forward to studying this document in detail. Mette Huberman As mentioned above, I care deeply about female artist recognition and appreciation, which would be a goal I would like to pursue as part of the commission s work. My art historical knowledge on the topic, as well as my experience working with stakeholders and artists as part of my evaluation work, will be very helpful in this process. I also care about digitizing art experiences by providing online interactive tours and information to reach as broad an audience as possible. Some of these already exist, such as the Temporary Murals project and the Airlift Microgrant Program, but I would like to work on digitizing all of Palo Alto s public art in similar ways to feature both the art and the contributing artists. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/21 Mette Huberman Mette B. Huberman 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Ian Klaus Ian Klaus 1002 Chileno Valley Rd Petaluma 9179222000 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU My current term of service as a member of the Public Arts Commission began in May 2018. During the course of the term, I have regularly joined the Commission meetings, served on a number of selection panels outside of the regular meetings, and worked with Commission staff to brainstorm on new ways public art could be used to bring together policy goals and cultural development, such as around climate change and the Sustainable Development Goals. Ian Klaus Current Serving Member Since 2017, I have served as an adviser to a number of cities and city networks on policy issues from the climate crisis to economic opportunity. My scholarly research over the same time has focused on enabling cities to address global challenges. This work has included policy development, but also efforts to use art and culture to explore and explain policy options. Prior to 2017, I served as senior adviser for global cities at the U.S. Department of State, and advised the director of Policy Planning and the secretary of State on issues related to both urbanization and cultural affairs. Chicago Council on Global Affairs Senior Fellow for Global Cities ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV In a March 17 joint meeting with the Human Relations Committee, PAC Chair Miyaji briefly mentioned discussions the PAC had concerning signage for public art, and possible options to ensure said signage is used to advance the Council's goals, and the equity agenda in particular. This should include signage for Public Art in Private Development. Art from the program is meant to be accessible and open to the public, but its location within private developments often hides this fact. Signage that made clear the right of the public to engage such art would advance equity while also developing an approach that other local cities with such a program could use. New responsibilities involve learning, and my contributions to the Public Art Commission, and in turn to the city's art more widely, have deepened and improved as I have grown more familiar with the program and the city. As such, I am seeking a second term on the Public Art Commission to take further advantage of the knowledge and experience I have gained. In particular, I have seen a strengthening of the relationship between Council goals and priorities and public art development. The Public Art Commission has directly engaged in support of the Council equity agenda and the Uplift Local effort. In early 2020, Commission goals and language for the year was brought broadly in line with city priorities. This synthesis - which with a background in policy and art I am well-situated to further - can help make the case for public art and help the Council deliver results for residents and visitors. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV During the application and interview process in 2018, I noted that I consider the Plan to be a framework within which we operate rather than something to be constantly renegotiated through new efforts. Since then, I have participated in numerous Commission meetings focused on the development of a similar such plan for California Avenue. Similarly, I feel that plan, and the orginal, help us focus on the development of public art projects that deliver on the goals laid out therein rather than having to constantly reinvent a new concept for art in Palo Alto. Oakland Mayor Libby Schaaf noted that 2020 featured dual pandemics, that of Covid-19 and that of systemic racism. The Public Arts Commission, following Council lead, was active on both fronts with the Black Lives Matter mural on Hamilton Avenue and the temporary mural project in support of Uplift Local. ITthe Commission should attempt to stay closely linked to the Council in such a way. The work has only begun on recovery and change around the dual pandemics, but the Commission should also pursue opportunities to engage with public art on additional Council priorities, including any significant discussions or changes around mobility, parking and climate change more broadly. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R April 6 2021 Ian Klaus Ian Klaus 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Emily Meyer Emily Meyer 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU My husband and I lived in Palo Alto between 1999-2004, years in which he attended graduate school and I founded my company at our apartment on Addison Avenue. Upon the birth of our second child, we returned to Palo Alto for its diverse community and strong public schools in 2010. While raising our children in the PAUSD system, our family has frequently participated in community organizations such as Palo Alto Little League, Palo Alto Art Center, and Pacific Art League, and regularly attended the community events May Fete and Festival of the Arts. As a parent volunteer, I have contributed time to All Students Matter, YMCA Project Cornerstone, Addison Elementary Site Council, and the Addison Equity Team. We have recently become members and contributed to the Palo Alto Community Fund. Emily Meyer Social Media, Instagram Co-Founder, & Chief Creative Officer, Tea Collection, $40M children’s wear lifestyle brand. Total of 25 years in the apparel industry. BFA, Fashion Design, Parson School of Design, New York, New York. CORO NorCal, Women in Leadership certificate Retired Executive 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV (See Portfolio) I appreciate art that inspires conversation and connection for all, evoking a sense of belonging and inclusion. Environmental art has the unique opportunity to engage people in the issues of preservation and social justice. Tangible play and interaction are powerful ways to engage all ages and abilities. Scale and location are tools for communicating captivating messages, accessing the public where they live, work and play. These pieces: Bucolic Labyrinth, Foraging Islands, Blue Trees, Bliss in the Moment, and the BLM mural, successfully calls attention to the values and engages the people of Palo Alto’s community. Emily Meyer Serving on the commission would combine my interests in serving our community with the best of my strengths and skills. As co-founder of a mission-driven lifestyle brand, I am and always have been, committed to inspiring global connection and curiosity through design. I would bring expansive entrepreneurial and professional experience to the position of commissioner. My journey includes starting and leading all creative facets of product design and marketing for my children’s apparel company, Tea Collection. With my business partner, I co-led a breadth of strategic and operational aspects from board communications and human resources management, to profitable financial discipline. As a member of the Addison Elementary School Site Council, I am currently leading the creation and installation of an extensive interior mural project for the newly constructed building on campus. This multi-year project has required ample concept development. Once engaging the appropriate design partner, we have been able to provide schematics for stakeholder feedback and lead discussions on feasibility and flexibility to meet execution and funding goals. I am also a member of the newly formed Equity Team at Addison Elementary, a group of staff and parents working to build empathy and trust for our community. I believe art and design are powerful tools for messaging values while illustrating norms of belonging. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV I have no specific experience with the Palo Art Public Art Master Plan. I have read it and understand the document as a guide for objectives and strategies. Emily Meyer (See Portfolio) If selected for a commissionership, I would like to help increase awareness of the Public Art Commission and its goal of creating an inspiring expression of Palo Alto. I see opportunities to work with local academic institutions identifying themes of Native American culture to reflect the foundation of our geography. I easily envision bold and energetic graphic art directing the public to the beauty and accessibility of public spaces in our community. Based on my work with Addison Elementary, I would propose a partnership with PAUSD to generate student-led artistry about themes important to their student body. With my skills, experience, and personality, I believe myself to be a strong candidate for the Palo Alto Public Art Commission. I would be a committed member and dedicated spokesperson using my authentic voice to amplify the creative and meaningful work, helping our community engage with art. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Emily Meyer Emily Meyer ++'$/$*)*-/!*'$*ϵ($'4 4 - '*'/*-/*(($..$*) +-$'ϬϪϬϫ $*"-+#4 Ѐ(+..$*)/ *0//# *)1 -./$*)!*-"'*'2- ) ..Љ+-/$0'-'4#*2+ *+' *!$1 -. 0'/0- .- '$5 2 - (*- '$& /#) $Ȃ - )/ϴ. *)/#$.+ -.*)'+#$'*.*+#4ϵ - / *'' /$*)ϵ#$'- )Ͻ.++- '*(+)4ϵ/* ($..$*)Љ-$1 )-) $).+$-$)""'*'*)) /$*))0-$*.$/4/#-*0"# .$")ϴ "- 20+$) 3.ϵ// ) -.*).#**'*! .$")$)ϵ)/# )(*1 /*)-)$.*ϵ'$!*-)$$)ϫϳϳϱϴ4#0.)) '$1 $)'*'/*$)ϫϳϳϳЉϬϪϪϯϴȅ -ϯ$/$*)'4 -.$))-)$.*ϵ2 - /0-) /*'*'/*$)ϬϪϫϪ/*-$. *0-!($'4ϴ - -$.$)"*0-/2*#$'- )$).#**'.ϵ2# - #1 ))/$1 1*'0)/ -ϵȅ -- /$-$)"!-*((4*(+)4$)ϬϪϫϲϴ 0$'/ *'' /$*)!-*(1$.$*)*!'$! ./4' -)2$/#( )$)"!0'1'0 .ϴ1 -4+-*0/2.- / 2$/#/# +0-+*. *!$).+$-$)"" 2- ) ..*!"'*'0'/0- .ϴ0-.*+#$./$/ ++- '*'' /$*)ϵ- # $)/ -)/$*)'0./*( -.*0/$,0 .) +-/( )/./*- .ϴ 0- !$)$)"-)/'*".0++*-/ *(( - ϴ.#$ !- /$1 Ȃ$ -ϵ ' 1 '*+( )/*!''+-*0/.)(-& /$)"*''/ -' Ж+-$)/ )$"$/'Зϴ *Љ' ''./-/ "$$)$/$/$1 .ϵ($)/$)$)"!$))$'+-*!$/$'$/4ϴ (( ). +'))$)")**-$)/$*)2.. - ,0$- /2 )- /$1 )./-/ "$ +-/( )/.ϵ(*/$1/$)"/ (./*2-'$")( )/$)#$ 1$)"0.$) ..*% /$1 .ϴ - . )/'4ϵ.( ( -*!/# $.*)' ( )/-4$/ *0)$'$)'*'/*ϵ (' $)"#$"#'4**-$)/ (0-'$)./''/$*)+-*% / /#-*0"#*0//# ) 2'4*)./-0/ ($)0$'$)"ϴ - . )/ # - $..(+' *!(4+-*! ..$*)' 3+ -$ ) ϵ++- $/$*)*!'*'/*0'$-/ϵ)$ .!*-0'/0- +0'$-/+-*% /.ϴ *'' /$*)ϵ*-/#( -$)/$1 -/$./ .$")-/) -.#$+.ϵ''ϬϪϫϲ 6KDZQHH6HPLQROH )%($) -%*-ϴ$VVLQLERLQH6LRX[0RWKHUGDXJKWHUJUDQGPRWKHUFROOHFWLYH-*URZLQJ7KXQGHUU KWWSVEORJWHDFROOHFWLRQFRPEHKLQGWKHGHVLJQQDWLYHDUWLVWV[WHDFROOHFWLRQ 0-- )/'4 $)" )/ -$*-0-'-*% /!*-$.*)' ( )/-4 *''*-/$1 Ȃ*-/ϵ. -1$)"/# ./0 )/.ϵ./Ȃ)*((0)$/4*!$.*)' ( )/-4ϴ ).+$- 4/- .))/0- ϵ(* -))./$(0'/$)""-+#$2*-& 1*& . 0-$*.$/4)2 ϴ ..0 .*! )/ - ./ ++- $/ -//#/$).+$- .*)1 -./$*))*)) /$*)!*-''ϵ 1*&$)". ). *! '*)"$)")$)'0.$*)ϴ )1$-*)( )/'-/#./# 0)$,0 *++*-/0)$/4/* )"" + *+' $)/# $..0 .*!+- . -1/$*)).*$'%0./$ ϴ )"$' $)/ -/$*)- +*2 -!0'24./* )"" $/$5 ).*!''" .)$'$/$ .2$/#+0'$-/ϴ# 0. *!.' )'*/$*)- 0)$,0 /**'.!*-*((0)$/$)"( )$)"!0'( .." .ϵ ..$)"/# +0'$2# - /# 4'$1 ϵ2*-&)+'4ϴ *-$.*)' ( )/-4#**'*((0)$/4 ( -.)'4Н- . )/ 4($'4 4 -ϩ $/#Ͻ-$ ) 0*'$ 4-$)/#45 ''5м$)"Ѐ.'5 (QJDJHVIDPLOLHVDQGFKLOGUHQ&UHDWHVDPRPHQWRIPHGLWDWLRQRQHQYLURQPHQWDOSUHVHUYDWLRQ *-"$)" .').4/ -.# 0'+/0- м43 -& *)0( )/'.' ϴ$. .2- ) ..*! )1$-*)( )/'+- . -1/$*)0. .ϴ)$,0 *((0)$/4+-/$$+/$*) '0 - .4*)./)/$)$(*+*0'*.м$)".'5 /-$&$)"$.+'4*!*'*-ϵ#*)*-$)"/# .4(*')1'0 .*!'*'/*ϴ '$..$)/# *( )/ϵ4( .**- м43 -& 3/-*-$)-4( /#**!24Љ!$)$)"ϴ$/#$/.*)/-./$)"$)0./-$'(/ -$'.ϵ/#$.+$ ''.// )/$*)/*4'$)"/-$'.!*-+ *+' /* )"" 2$/#/# +- . -1 )/0-' .+ .ϴ '& $1 .// -0-'м ($'/*)/- / 0/$!0'$.+'4*!$1 -.$/4ϴ (+- ..$1 /$1/$*)/*+-/$$+/ $))/$*)Љ2$ -''4!*- ,0$/4ϴ .ϩ*'.!*-/# 0'$-/*(($..$*) !. ' / !*-*(($..$*) -.#$+ϵ 2*0''$& /*# '+$)- . 2- ) ..*!/# 0'$-/*(($..$*))$/."*'*!- /$)") $).+$-$)" 3+- ..$*)*!'*'/*ϴ . *++*-/0)$/$ ./*2*-&2$/#'*' ($$)./$/0/$*).$ )/$!4$)"/# ( .*!/$1 ( -$)0'/0- /*- !' //# !*0)/$*)*! *0-" *"-+#4ϴ .$'4 )1$.$*)*') ) -" /$"-+#$-/$- /$)"/# +0'$/*/# 0/4) ..$$'$/4*!+0'$.+ .$) *0-*((0)$/4ϴ. *)(42*-&2$/#$.*)' ( )/-4ϵ 2*0'+-*+*. +-/) -.#$+2$/#/*" ) -/ ./0 )/Љ' -/$./-4 *0//# ( .$(+*-/)//*/# $-./0 )/*4ϴ 2*0''$& /*. /# 0$'$)")./- )"/# )$)"*!- '/$*).#$+.(*)"$1 -. "-*0+.ϵ- /$)"*)) /$*). /2 )/# +0'$2$/# -/$./.)/# $-( )$)"!0'2*-&ϴ Н Љ Н м(+0. . *-$.*)' ( )/-4#**'*((0)$/4 ( -.)'4Н- . )/ 4($'4 4 -ϩ $/#Ͻ-$ ) $/#+-/) -.ϵ0$'2- ) ..*!/$1 ( -$)0'/0- .ϴ -/) -2$/#/)!*-)$1 -.$/4ϵ . )/ -!*-0'$ -1$ /* ' -/ )/$1 0'/0- ../# !*0)/$*)*!*0-" *"-+#4ϴ #'*) $''" 0-'4))#$ -())м)/-050. 0(*!/0-' $./*-4 . '-" .' "-+#$-/!*-''$)"// )/$*)/*+0'$.+ . 4)($24!$)$)""-+#$.$.)*++*-/0)$/4!*-$)- . *((0)$/4 )"" ( )/ϴ 3/ -$*- -($0-'м$.*)' ( )/-4 *''*2$)"# -$/" (+0.-/2*-&ϵ- / *((0)$/4Љ0$'$)"*++*-/0)$/4!*-+0'$ 3+- ..$*)*! ,0'$/4)$)'0.$1$/4ϴ 3/ -$*-$)/ 0-'.м(+0. . *' 3+- ..$*)*!4*0/#ϵ*'*-)- /$1$/4ϴ)"" .4*0/#)*((0)$/4*!+0'$.#**' $./-$/ϴ *$' )"" ( )/ )/ -. +0-+*. /# *$' -/.'/!*-(!*- )""$)"!($'$ .ϩ#$'- )/+0'$.+ .ϵ- /$)"2- ) ..*!/# '*'/*0'$-/.*(($..$*)ϴ #)&4*0!*-/# *++*-/0)$/4/*++'4ϴ $/#(4.&$''.ϵ 3+ -$ ) ϵ)+ -.*)'$/4ϵ '$ 1 (4. '!/* ./-*)")$/ !*-/# '*'/*0'$-/*(($..$*)ϴ 2*0' *(($// ( ( -) $/ .+*& .+ -.*)0.$)"(40/# )/$1*$ /*(+'$!4/# - /$1 )( )$)"!0'2*-&ϵ# '+$)"*0- *((0)$/4 )"" 2$/#-/ϴ Please email all oompleted applications to Jessica.Bra ~CityofPaloAlto.org or Clty.Clerk@CltyofPaloAlto.org Public Art Commission Personal Information -Note : The PAC regularly meets the third Thursdays of the month at 7:00 P.M. Name: Ben M iyaji Address: ~I Phone ~ome office Phone: E·mail: Are you a Palo Alto Resident?Oves®No Do you have any relatives or members of your household who are employed by the City of Palo Alto , who are currently serving on the City Council, or who are Commissioners or Board Members?QYes (!)No Are you available and committed to complete the term applied for?®ves ~o California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (fair Political Practices Commi$S.iQo, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to ; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or comm ission you are applying for? ()vea{!)No Excluding your principal residence, do you or your spouse own real property in Palo Alto?Oves®No Consent to Publish Peraonal Information on the City of Palo Alto Webtlte California Government Code Section 6254.21 states, in part, "No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual. a This consent form will not be redacted and will be attached to the Application and posted to the City's website. For the full code, review the California Government Code Section 6254 .21 Read the code , and check only ONE option below: Q I give permission for the City of Palo Alto to post to the City's website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City's website. I am providing n following atte1 nate n vr on a .d request that I'! '/ 1 e the following contact Information Instead. Address: Cell Phone: Oome Oottice Phone: E-mail: Page 1 Public Art Commission How did you learn about the vacancy on the Public Art Commission? ........ Commun ity Group D Daily Post Ema il from the City ........ Palo Alto Weekly Other: Member of the p11hljc Art Cgmmj55jgn City Website 1--1 Flyer List relevant education, training, experience, certificates of training , llcenaes, or profeaalonal registration: (621 characters) I have served on the Palo Alto Public Art Commiss i on (PAC) since 2013 . I have been the chair for the past two years. I currently am a member of the Arts & Culture Commission of Contra Costa County. I served on the San Jose Arts Commissi on from 1992-2014 and held various leadership positions including Chair for three consecutive years. I have also served many non-profit boards. Employment D Current Employer Employer: Siemens Occupation : Senior Engineer I./ I Last Employer Describe your involvement in community activities , volunteer and civic organizations : (1311 characters) Through my service on various comm issions over the years , I have been i nvolved in many community acti vities, includ i ng : •121Chair of the San Jose Mineta Internationa l Airport Public Art Master Plan steering comm i ttee. The 30-person committee consisted of two city council members and various leaders of the community. •12!Speaking at various openings of community centers, libraries and public art pieces. •IMttending numerous events to engage w ith attendees about their experiences and reasons for attending funct i ons. •OOrganized community events for the entertainment of the population . I am also a wedding officiant and performed over 6,000 wedding ceremon i es. Many of these ceremonies have been performed as a volunteer offi ciant for the County of Santa Clara. Page2 Public Art Commission 1. Why are you Interested in serving on the Public Art Commission and what experience would you bring to the position? (151 B characters) Public art tells the story of a community and shows it soul. Bringing public art to the community, not just the downtown areas but into the neighborhoods would enliven these areas. My almost 3C year experiences serving on various commissions would be an asset in the public art program . 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) The idea of a Racial Equity art piece was brought to the Public Art Commission by the city council. The commission is finalizing plans for this project and will forward to the city council shortly . Thi s is of vital importance to the community as we move forward and include all peoples in city activities. Page 3 Public Art Commission 3. If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) In conjunction with the Human Rights Commission (HRC), the Public Art Commission (PAC) has started a collaboration about the importance of Racial Equity in our community. The unique perspectives of the HRC and PAC, while diverse in nature are a natural fit to bring the meaning of Rac ial Equity to Palo Alto. 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan I served as chair of the Palo Alto Public Art Master Plan Steering Committee. I am well versed in the plan and the master plan helps the commission formulate its work plan for the coming year. Page4 Public Art Commission 5. Please conflnn that you have read the Boards and Comml88lona Handbook: .{!Lvea Q No Page 5 Public Art Commission 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Cleia Dantas Muggler Cleia Dantas Muggler 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Since moving to Palo Alto over 10 years ago, most of my involvement in the community has been through volunteer work at different PAUSD schools. I started as a volunteer at Juana Briones Elementary School, which my children attended. I held several roles, from teacher's assistant, library helper, to noon activities coordinator. While being a volunteer at Briones, one of the most significant projects I contributed to was a community artwork in honor of local Japanese families that had relatives affected by the 2011 Tsunami. A few years later as my kids moved to Hoover Elementary School, I became an executive board member of the Parents and Teachers Association (PTA) and served as the financial secretary. It was a great opportunity to learn more about the school's community and contribute to the school's programs and activities. The following year, I became the PTA's treasurer at Terman Middle School (now Ellen Fletcher Middle School), a role that lasted two years and allowed me to make significant and long-lasting contributions. During my last year at Fletcher, I was the co-Chair for the 8th-grade Promotion Committee. My role included the planning and execution of the graduation party along with other parents. Cleia Dantas Muggler I have a bachelor's degree in Finance from P. Carey School of Business at Arizona State University, an Associate Degree in Arts from Foothills College specializing in Graphic and Interactive Design, and a master's in fine arts from San Jose State University with an emphasis in Digital Media Arts. Here is an example of one of my latest work http://cleiamuggler.com/recollection.html For more details about my background, please visit https://www.linkedin.com/in/cleiadantasmuggler San Jose State University ✔ Teaching Associate ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV The safety and well being of our citizens are the most important issues in Palo Alto. Since moving to Palo Alto, my neighborhood has experienced the worst tragedy a parent can experience at the Caltrain train intersections at Meadow and Charleston roads. Those tragedies raised several important issues; however, the city has yet to come with a solution for our residents that goes beyond a crossing gate. I believe that by using art as a medium, we can offer a helping hand to members of our community who suffer from depression and anxiety. Perhaps, creating better connections between art programs funded by the City of Palo Alto and local schools can help prevent some future tragedies. Another hot topic is the expansion of rail service to include the California High-Speed Rail. This major development will significantly transform our community and therefore it is being resisted by many members of our community. This development is an important undertaking for our economy and the environment. However, it can be an overwhelming disruption to the lives of many members of our community. Perhaps, through the arts, we can bridge the gap between the proponents of the High-Speed Rail and the opposition. Arts might help to drive a common understanding of the benefits and foresee the actual impact of this development, leading to a more educated conversation and better outcomes for everyone. Cleia Dantas Muggler Besides raising a family and volunteering in several positions at PAUSD for the past few years, I also managed to go back to graduate school and pursue a masters degree in digital media arts at San Jose State University where I graduated in June of 2020. During my graduate studies, I was involved in the university's art community where I contributed, with fellow artists, to art shows and I thought introductory art courses to university students. Furthermore, I attended several artists' lectures, participated in international art conferences, organized gallery openings, and created my own exhibitions. The two and a half years I spent at SJSU greatly expanded my knowledge of the arts and its impact on society. I greatly appreciate the connections and friends I made at SJSU and across the world. I believe that having a position in the Public Art Commission will be a great opportunity to be involved in a subject that I am very passionate about. Most importantly it will allow me to contribute to Palo Alto's art community by utilizing the knowledge and experience I acquired over the years as a researcher. Furthermore, my professional background in accounting and finance will help overcome the challenges many art projects face, proper funding. The city of Palo Alto has done an incredible job in providing its residents access to innovative artworks, I can effectively contribute to the continuing facilitation of access and support the implementation of the city's Public Art Master Plan. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Cleia Dantas Muggler From my perspective, it seems that the many wonderful initiatives from the Palo Alto Art Commission are not reaching a wide enough audience. Thus, my work would also involve outreach work to increase engagement and awareness throughout the community. A second goal would be to help younger generations get engaged through art events. This work could be executed with the help of local artists as well as students and faculty from SJSU and Stanford for instance. Connecting the different art communities in the Bay Area and inviting them to participate in events in Palo Alto would help expand the opportunities and make a difference in our community. This work will help aspiring young artists develop their talents as well as express their sentiments and be better understood. Palo Alto has the space and talent to execute those exciting initiatives. All it needs is greater engagement within our community and outreach to neighboring areas. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Cleia Dantas Muggler Cleia Dantas Muggler 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Harriet Stern Harriet Stern 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU In my community I have taken a number of classes at Pacific Art League, Mid-Peninsula Media Center, The Art Center. I attend lectures and music at Stanford, visit arts programming often at all sorts of venues from open studios to the Anderson collection and everything in between. We attend lots of community and regional theater. My kids are in PAUSD since 2018. Palo Alto Weekly subscriber. My volunteering is majority around school. I try to do one long-term commitment a year coupled with as many one-off assignments possible. To give an example these are my recent longer term volunteer commitments: Odyssey of the Mind Coach, Elementary Division—2017 World Championship Qualifiers, All Students Matter Literacy Volunteer, Ravenswood School District 2018/19, Palo Alto High School, College Career Center/Career Speaker Series Volunteer 2019/20, 2020/21, The Reach Foundation Mentor, Santa Clara High School 2020/21. Political Volunteer 2020. Harriet Stern BA, Art History, Kenyon College, Gambier, OH Graduate Studies, Modern Art History ,Theory and Criticism, School of the Art Institute of Chicago Diploma, Interior Architecture, Inchbald School of Design, London Internships: Hirshhorn Museum , Washington D.C.; Peggy Guggenheim Collection, Venice, IT; Chicago Park District, Archives Dept.; Art Institute of Chicago, Dept. of 20th Century Art TA, School of the Art Institute of Chicago Asst. Director, White Pine Gallery, Chicago Corporate Art Consultant, Merrill Chase Galleries and Corporate Artworks, Schaumberg, IL Curator, IBEW Local 1245, Vacaville, CA Corporate Art Works, Arlington Heights, IL ✔ Corporate Art Consultant ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV At the February 2021 meeting the PAC was asked by the City Council to consider Racial Equity as the theme for artwork for King Plaza at City Hall. During the discussion Mayor DuBois suggested that some Palo Altans may be unaware that King Plaza is named for Dr. AND Mrs. King. I presumed it was named after MLK. It warmed my heart to know that our city valued Mrs. King as an equal to her husband in the dedication of this plaza in 2008. It followed in the meeting that perhaps this should be the focus of the PAC: a better way to inform Palo Altans that King Plaza is named for Dr. AND Mrs. King. This is the issue which is of particular interest to me. During the discussion it was disclosed that: fewer people visit City Hall due to paperless commerce and communication; there are severe weight limitations for art or objects due to the parking garage under King Plaza; the Plaza is higher in the middle than on one side; there may be rules about moving the dedication plaque. Given the above, I suggest a sound installation wherein a touch pad is embedded under the tile so that as the foot strikes, Dr. King’s voice is triggered and rings out from a hidden speaker. One can take in a few lines of his poignant oration. In another part of the plaza, the same sequence of events produces the voice of Mrs. King, delivering her own brand of discourse. Repeat in different areas, with varying types of communications from the Kings and it will be clear the plaza is named for Dr. and Mrs. King. Harriet Stern With our abundant and diverse public art, Palo Alto communicates that creativity and open expression are celebrated here. Our artworks illustrate our community’s values and vision. The Public Art Commission serves a critical role in the direction of this vision—aesthetic and sociological. My interests in serving on the Public Art Commission are manifold. My primary objectives are to: 1.ensure that permanent acquisitions and temporary installations reflect Palo Alto’s values. 2.attempt to reach segments of the community not currently engaged by the public art program and build greater awareness about the program and the collection. 3.guarantee that the community trusts that decisions made around public art are completely transparent and accountable. 4.support local artists and promote art within the community. 5.continue the long-term plans established in the Public Art Master Plan and New Cal Ave Plan and strategize future long-term needs for the collection and programming. As a lifelong collector and professional in the arts I have practical experience working with artists, end-users, framers, auction houses, printers and installers on project development, proposals, acquisitions, commissions, and installations. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Yes, I am familiar with the Master Plan. I attended a focus group with the authors and have read the final document. I know that we are about halfway through the ten year plan. The Master Plan has effectively established a professional approach to our Public Art Program and its administration. The goals and timeline are very clearly stated. The Cubberley Artist Studios are included in the Master Plan as a point of discussion. It is my very strong opinion that if Cubberley is used for something else in the future, Palo Alto should maintain subsidised artist studios somewhere within our city limits. Artists enhance diversity of our community. They can't afford to be here without our support. Harriet Stern Proactively fight Hate with Art. For example: 1.Use city transportation as circulating artworks by pairing a visual artist with organizations which experience intolerance, xenophobia or racism to develop conceptual artwork which then become vehicle wraps. Thus, you make a powerful statement about inclusion, an important Palo Alto value, which literally travels the streets. Doing a quick search, I found local groups we might consider teaming with to create the "Coexist Coach" or "Tolerance Transporter": NAACP of SV, Nuestra Casa, American Muslim Voice Foundation, The LGBTQ Youth Space and WizChinese. 2.Make Race and Equity the focus of the Temporary Art Program at King Plaza. 3.Create an Artist in Residency program wherein an artist (nonwhite male) is embedded in the Palo Alto Police Department. The artist produces a piece to be displayed in the vicinity of the new Public Safety Building. Build Bridges with Art. Here are some ideas: 1.Encourage cooperative projects between East Palo Alto and Palo Alto. 2.Work with our International Sister Cities on arts exchanges. 3.Be more collaborative with Cubberley Artists and review and revise the program. 4.Mayor DuBois’ initiative for Sister Cities within the US would produce a rich exchange for artists as well. Likely we can find artists to meet via Zoom to discuss the State of Art Making and exchange ideas. It would great to get a room full of our artists together with a room full of artists from the coast of Massachusetts or central Indiana or Arkansas for example to find out what inspires and challenges them. I am excited to participate in any of the above processes. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 03/31/2021 Harriet Stern HARRIET STERN Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursdays of the month at 7:00 P.M......... Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Public Art Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website clear and communicative materials to be disseminated online and via social Lisa Waltuch Lisa Waltuch Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Public Art Commission How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer ✔ Self-Employed artist and designer ✔ While living with my family in Costa Rica for three years, I started a bilingual storytelling event series modeled on the approach of "The Moth." I recruited and coached storytellers, found musicians and MC, coordinated volunteers to help with marketing, venue logistics and food/drink. We hosted international storytellers in our community from Brazil, Australia, England, Costa Rica, Canada, US, Argentina and more. This past summer and fall I worked with a small group of people through Future Now Fund to create a giving circle. Our goal was to invite as many people as we could to make individual contributions that could add up to enough money to flip our chosen state legislatures from red to blue. We gathered a community of 500 people between the ages of 14-86, from 31 states and raised $156K in 77 days. For 10 years, I served as a board member for WomensLaw.org, a web-based non-profit organization for victims of domestic violence and their advocates. My responsibilities included: board decision-making, fundraising and design consultation. Lisa Waltuch Lisa Waltuch Studios PROFESSIONAL EXPERIENCE: Practicing Artist - Uses art to tell people's stories. See lisawaltuchstudios.com and lisawaltuchsilkstudios.com. Storytelling Producer - See scherezadestorytelling.com. 20 year career as a Creative Director (The Met, Walmart, others) EDUCATION: Rhode Island School of Design, MFA, Graphic Design, Stanford, BA, Design and Art History, Node Center for curatorial studies: coursework in curation TEACHING: Adjunct Faculty at NYU's Interactive Telecommunications Program EXHIBITIONS: Art Basel Miami, The Fearless Artist Gallery Page 3 Public Art Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) 1. Why are you interested in serving on the Public Art Commission and what experience would you bring to the position? (1518 characters) I am interested in serving on the Public Art Commission so I can make a lasting contribution to my community due to my work as an artist, my experience as a designer and my belief that exposure to art leads to both an understanding of differences and a better quality of life for all. I grew up in Palo Alto and attended Terman Jr. High, Gunn High School, Stanford University and worked as a graphic designer for several design firms in downtown Palo Alto. My mother worked for the city of Palo Alto teaching dance exercise until she was in her 70s at Lucie Stern. After my local experiences, I lived on the East Coast and then in Costa Rica, building a successful professional career, delving deep into the worlds of design, art, and culture, and starting a family. Two years ago, I returned home: my three children happily attend Juana Briones, Fletcher and Gunn and have all participated in Palo Alto Children's Theater productions. I have friends, family and professional relationships here. I am excited not only to dive into the flourishing creative community here, but to bring my experiences and perspectives from my life outside of Palo Alto back to my hometown. In particular, I am excited to lead efforts to use art to knit together the beautiful diversity of Palo Alto. I am interested in some of the themes that emerged from the Commission meeting on March 18, 2021 including addressing cultural, racial and ethnic diversity and social justice in public art. In the time that I left and then returned to Palo Alto, it has become an incredibly diverse and vibrant international community. Yet many groups feel that their voices aren't heard, or that their issues are not represented. As I learned from living in diverse communities in Brooklyn, NY and Costa Rica, art, a universal language with the ability to cut across all cultures, can bring these groups together and allow everybody to be seen and heard. We can help answer the question: Who are we as a community composed of many different cultures? What kind of metaphorical quilt can be made with these wonderfully different fabrics? As an example, the Commission could sponsor an artist to create an interactive public art piece that includes a diverse group of local citizens from as many backgrounds as possible, contributing in their own unique way. Page 4 Public Art Commission 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan 3. If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) 1. Demystification of public art commissions. I will use my design skills to develop clear and communicative materials to be disseminated online and via social media. 2. Residency program. A "residency" could be developed in which an artist teaches adults and children in the community and then works with those students to create a temporary piece of public art. My Brooklyn community has an excellent example of how this can work. I would work with my colleagues to secure funding. 3. Relationship between tech and art. Since our area is known for technology, opportunities for forging a connection between public art and tech are ripe in Palo Alto. Examples of art and technology merging continue to grow in digital, interactive, the maker movement, and even $69M NFTs! I would like to work on projects that build relationships between the two industries. 4. Collaboration between functional city projects and commissioned artists i.e. bike racks, public restrooms. When I was a graduate student at RISD, my Dutch professors had designed the money, postage stamps, phone booths, mailboxes for Holland. Palo Alto, too, can use design to improve public life. 5. Public art as an interactive and collaborative experience. By definition, interactive art engages people to create a sense of delight and shared sense of pride. The subject of my MFA thesis was collaboration and most of my art is collaborative. One of my favorite museums is MOMATH in NYC where everything is interactive and everyone is having fun! Let's bring collaborative art to Palo Alto and engage the community. I have closely read this the Public Art Master Plan and understand the value of a having a comprehensive plan to guide the work of the Public Art Program in Palo Alto. It was well researched, with sound recommendations and suggestions in planning, outreach, exposure and inclusion of artists on city boards and panels. Implementation of this plan will contribute to the future of putting Palo Alto on the map with its public art. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Public Art Commission 5. Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No Lisa Waltuch Lisa Waltuch, 4/6/21 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Mark Weiss Mark Weiss 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I founded Earthwise Productions in 1994; in some ways it was a spin-off of Bay Area Action's Bay Area Earthday at Stanford, for which I volunteered. I produced 150 concerts at Cubberley, roughly twice a month for six years. The parent of an attendee, Gerald Brett suggested then I apply for the arts commission. I helped him hire a band called Monkey to play the unveiling of Marta Thoma's "Go, Mama" on Cali Ave. Between October, 2018 and March 13, 2020 I produced 18 concerts at Mitchell Park El Palo Alto Room. In 2009, Mayor Drekmeier recruited me to help Commissioner Ezran produce World Music Day. I later ran for City Council in 2009, 2012 and 2014. I've applied to four other boards or commissions a total of five times. I've likely spoken to boards and written to council on the arts, freedom of expression or The First Amendment 100 times. I'm an in-kind donor to The DeYoung Museum. I collect art. In 5th grade I was in the PAUSD student show, a work on paper, a water color depiction of King Tut flashing a peace sign. In 1982, for the Gunn Oracle, on April Fools' Day, along with future Academy Award winner Jessica Yu and future "Just Shoot Me" producer Marsh McCall, I creative-directed a series of photographs of "Jim Harbarph" dunking, cheering, chewing tobacco. Mark Weiss Gerald Brett, former Arts Commissioner Gunn High School, class of 1982 Dartmouth College, class of 1986 Palo Alto City Council, candidate for office, 2009, 2012, 2014 Palo Alto boards and commissions candidate five times, 2010-2017 Earthwise Productions (President) ✔ concert promoter / arts administrator / activist ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it. $rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV I wrote a letter to the editor about We The People honoring Nathan Oliveira by purchasing Sons of the Golden West Building at 209 Hamilton which in the 1960s was a studio for artists and depicted in his "stage paintings". Council member Gail Price later read a proclamation into the record along similar themes. I support Percent for Art for public buildings only and not for private ones. I support performance arts as part of the Arts Commission purview. I like the graffiti at Greer Park skateboard facility even if it's not in the collection per se. I am wondering why there is no public art at the new garage on Sherman Avenue. I published on my blog the comp by Ala Ebtekar and Binta Ayofemi "Blue Tunnels" (2015) I think tax dollars should go towards more work like that of Greg Brown, Mohamed "Slim" Soumah, Joey Piziali, Chris Johanson, David Huffman, Peter Wegner, Sam Yates, Micheal Szabo, Bruce Beasley, Joan Zalenski, Nathan Oliveira, Joe Zirker, Stu Robertson, Fletcher Benton and Joe Sam. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV I had written roughly 1,000 posts on my blog, Plastic Alto, during the time we were updating the Comp Plan. The name of my blog references jazz musician Ornette Coleman, who played an acrylic alto sax. Literally a plastic (not metal) alto (not tenor or baritone). The name also relates to the artificial turf soccer fields at Page Mill and El Camino and how different the game looks if you focus on those tiny, black fake pebbles that fly when the ball lands and not the ball per se, nor the players, the goal or the scoreboard. Could we self-govern better and have a more just society if we and especially our leadership thought regarding policy more like artists do? In some ways, and paradoxically, we would not need an arts commission then. Even when we disagree about the merits of a particular piece of public art in our collection -- or the value of the program as a whole -- that dialogue, discussion, debate or argument becomes, in a way, the commons, ours, something we share, Palo Alto. Much of my work comes out of a statement made by Donald Judd, the minimalist sculptor, to the SF Chronicle about how our ability to discern or to note small differences in art is crtical to our ability to self-govern and not be subjected to tyranny. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3/15/2021 Mark Weiss Mark B. Weiss 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Stephanie MacDonald Stephanie MacDonald 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I have been a volunteer for Pets In Need since August 2018 at the Redwood City location. Pets In Need is a local animal shelter with locations in Redwood City and Palo Alto. As a dog volunteer, I walk dogs and provide enrichment and companionship. Since COVID-19, volunteer numbers have been limited, so I haven't been able to switch to the Palo Alto location after I moved cities, but I plan to volunteer there once it is safe to do so. I am also a volunteer with Peninsula for Everyone, a non-profit housing and transportation advocacy group. As a member, I partake in monthly meetings, am involved with community organizing, and speak at local meetings in support of various projects. Stephanie MacDonald As Senior Engineering Technician with the City of Foster City, I am directly involved with our stormwater pollution prevention program, in which I perform inspections as a Certified Stormwater Inspector for development sites and businesses in the City as required by our Municipal Regional Permit. I understand and implement our Enforcement Response Plan, and have direct field experience with stormwater management practices. I also help educate site reps and businesses of regulations and best practices. I assist in compiling the City's Annual Report to the Regional Water Board, and I partake in regular trainings. City of Foster City ✔ Senior Engineering Technician ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW I understand the implementation, purpose, and intent of the Stormwater Management Fee Ballot Measure and am able to interpret various regulatory and municipal documents. While I do not have much direct involvement with Storm Drain Master Plans, Sustainability and Climate Action Plans, or Green Stormwater Infrastructure Plans, I do understand much of the planning involved and I am aware of many of the implications and actions that come from these types of plans. I am familiar with City Annual Budgets, as I assist with aspects of the Foster City budget that pertain to my role. I am also Chief Shop Steward for the City's Union members, where I participate in bargaining and have a comprehensive understanding of our contract and the City's financial standings. Fostering communities that are healthy, sustainable, and conscious is a mission I strive to implement in both my personal and professional lives. I have been an advocate for conservation and the environment from a very young age, and I have always strived to do my part in preserving our natural surroundings. This commitment stays with me even stronger today, and it is what draws me to this exciting opportunity. I believe that my enthusiasm, along with my technical knowledge in stormwater best management practices, would make me a great fit for this opportunity. I possess a strong dedication to my work, and I would love to be a part of this committee to help preserve our natural networks in Palo Alto and the surrounding areas. Stephanie MacDonald 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/4/2021 Stephanie MacDonald Stephanie MacDonald Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org Storm Water Management Oversight Committee Personal Information -Note: The SWMOC meets on an as needed basis Name: Hal M Mickelson Address: Cell Phone: ~ome G ffice Phone: E-mail: uncleha lpaloalto@gmail.com Are you a Palo Alto Resident?@ Yas Q No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members?Q Yes @ No Are you available and committed to complete the term applied for? ®vas ~o California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission , Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Oves ®No Exduding your principal residence, do you or your spouse own real property in Palo Alto?Ovas®No Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, "No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual." This consent fotm will not be redacted and will be attached to the Application and posted to the City's website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: Q I give permission for the City of Palo Alto to post to the City's website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City's website. I am providing the following alternate information and request that they use the following contact information instead: Address: Post Office Box 20062, Stanford, California 94309 Cell Phone:650 868 2938 ~ome O office Phone: E-mail: unclehalpaloalto@gmail.com Hal M Mickelson Page 1 Storm Water Management Oversight Committee How did you learn about the vacancy on the Storm Water Management Oversight Committee? (Select more than one if applicable) Community Group Email from the City Palo Alto Weekly OoailyPost D City Website DFlyer Other: I'm a member of the Committee and was encouraged to re-apply. List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) I've served mutiple terms on the Storm Water Management Oversight Committee and its predecessors. I'm currently its Chair. I served on the Blue Ribbon Task Force that formulated the parcel fee proposal to fund Storm Water Management presented to the city's residents in 2017 and was a member of the campaign committee for the proposal. My undergraduate degree is from Stanford, A.B., 1971, and my law degree from Harvard, J.D., 1974. I practiced law for four years in San Francisco and for 37 years in Palo Alto as a member of the corporate legal staff at Hewlett-Packard. Active member, State Bar, No. 62132. Employment D Current Employer Employer: Hewlett-Packard Company Occupation: Corporate Counsel I.ti Last Employer Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) I'm a member, past president and past board member of the Rotary Club of Palo Alto; current board member for the Palo Alto History Museum; past board member for the Palo Alto Chamber of Commerce, Palo Alto Area Chapter of the American Red Cross and Stanford Daily Publishing Corporation. Hal M Mickelson Page2 Storm Water Management Oversight Committee 1. Why are you interested in serving on the Storm Water Management Oversight Committee? (1518 characters) Pm hoping that the expertise and insight that I've developed through past service on the Committee will continue to be useful to other committee members and the city staff. 2. Storm Drain Oversight Committee Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not reuired for selection. (1518 characters) 2017 Stormwater Management Fee Ballot Measure 2015 Storm Drain Master Plan Sustainability & Climate Action Plan (2020) Green Stormwater Infrastructure Plan (2019) City of Palo Alto Annual Budget I think it's fair for me to call myself an "author" of the 2017 Stormwater Management Fee Ballot Measure as one of the dozen or so people who served on the Blue Ribbon Task Force that formulated the measure. I've studied many years' worth of plans and budgets for the Storm Drain Utility Fund; I've participated in many reviews and discussions of Green Stormwater Infrastructure and staff plans and proposals relating to sustainability. Hal M Mickelson Page3 Storm Water Management Oversight Committee 3. Please confirm that you have read the Boards and Commissions Handbook: .®,ves Q No Signature: (Please type or sign) _H_al_M_. _M_ic_k_e_ls_o_n _____________ Date: April 6, 2021 Hal M Mickelson Page4 Stonn Water Management Oversight Committee Storm Water Management Oversight Committee Personal Information – Note: The meets on an as needed asis Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Storm Water Management Oversight Committee Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Dena Mossar Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Storm Water Management Oversight Committee How did you learn about the vacancy on the Storm Water Management Oversight Committee? (Select more than one if applicable) __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Palo Alto City Council, 1998 - 2007 San Francisquito Creek Joint Powers Authority, Director, 1999 - 2007 Bay Conservation and Development Commission, Commissioner, 2005 - 2007 Bay Area Air Quality Management District, Director, 1999-2004 Bay Area Water Forum, Delegate, 2002 - 2007 Valley Transportation Authority, Director, 2002 - 2003 National League of Cities-Energy, Environment & Natural Resources Steering Committee, Member, 2001 - 2007 Storm Water Management Oversight Committee, Member and Vice-Chair, 2017 - 2021 Library Bond Oversight Committee, Member I am currently serving on this commi3ee see below City of Palo Alto City Council Member ✔ 2. Page 3 Storm Water Management Oversight Committee Storm Drain Oversight Committee Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not reuired for selection. (1518 characters) 1.Why are you interested in serving on the Storm Water Management Oversight Committee? (1518 characters) 2017 Stormwater Management Fee Ballot Measure 2015 Storm Drain Master Plan Sustainability & Climate Action Plan (2020) Green Stormwater Infrastructure Plan (2019) City of Palo Alto Annual Budget These are documents that I would have worked with as a member of the committee. I would like to con.nue my service on this commi5ee for a second term. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 4 Storm Water Management Oversight Committee 3.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No 4/3/2021Dena Mossar 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Catherine Perman Catherine Perman 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I participate and volunteer with Zohar Dance School (Cubberly Center). Worked as an election clerk in local and national elections. While my daughter was in Palo Alto schools (K-12) I volunteered in the classroom and with Palo Alto Community Child Care. Did some native plantings as volunteer with Save the Bay. I wish to increase my involvement in our community. Hence my application to the Stormwater committee. Catherine Perman Worked as environmental engineer. Pivoted to tech career in software engineering and management. Technical work: data analysis, financial compliance and systems security. Retired in 2019. Currently working on data science projects using open source tools. Ph.D. 1990, Stanford University, Stanford, California. Civil and Environmental Engineering. Improving the Performance of Wastewater Treatment Plants: an Expert Systems Approach M.S. 1984, Utah State University, Logan, Utah. Civil and Environmental Engineering B.A. 1975, Brown University, Providence, Rhode Island. Geology/Computer Science Endicia/Stamps.Com ✔✔ Engineer ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW •home native garden with some drainage issues. Learned about stormwater rebate program via installation of rain barrels arranged with drainage diversion away from house. Currently learning about the rain garden concept and possibilities for my yard. •attended a couple of webinars (during SIP) regarding green projects to increase wetlands water absorption and create flooding barriers in Baylands. •seeing programs in action along the Baylands. •with a stormwater drain at the corner of my property, I’m well aware of its various benefits and problems. For example, keeping leaves and debris from blocking drainage. Witnessing how repaving the street (good) changed drainage patterns (not so good). So city programs that aren’t directly stormwater related can impact stormwater infrastructure. * I have read the linked documents but never worked with them. I find stormwater related issues compelling. As an almost hidden aspect of urban infrastructure, stormwater management is rarely in the news until disaster strikes and impacts are apparent. So staying ahead of potential disasters is critical. Stormwater management directly aligns with my experience in project management, water resources, water quality and groundwater management. Much of my more recent hands-on experience is with data driven financial auditing. Reviewing capital improvement and monitoring expenditures align with my financial interests. Work done by the committee seems like an excellent fit and would give me an opportunity to contribute back to the Palo Alto community. Catherine Perman 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Catherine Perman Catherine Perman 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Bob Wenzlau Bob Wenzlau 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU President, Neighbors Abroad Founder, Repair Cafe Member, Center for Pubic Environmental Oversight Zero Waste Block Leader Bob Wenzlau Existing Member Bachelor & Master Degree, Civil & Environmental Engineering, Stanford University Registered Civil Engineer, State of California (inactive registration) Member, Storm Water Management Oversight Committee Terradex, Inc. CEO, Civil/Environmental Engineer ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW - Co-chair of Campaign for 2017 Stormwater Management Fee Ballot Measure - Presented Sustainability & Climate Action Plan to sister city, advised on solid waste elements. - Participated as member of Storm Water Oversight Committee in discussion and approval of the Stormwater Infrastructure Plan (2019) I am interested in supporting fiduciary oversight of annual dispersement of funds for stormwater management. Additionally, I am interested in supporting progress in green infrastructure as well as innovative programs including rainwater capture in residential sector. I also encourage broader engagement on the committee including use of art to develop engagement with our environment, as well as interaction with sister cities to bring fresh ideas to the oversight committee. I have supported staff in development of their web presence for these programs. Bob Wenzlau 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3/28/2021 Bob Wenzlau 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQJohn Bowie John Bowie 233 Sansome Street, Suite 400, San Francisco CA, 94104 408.868.8634 johnbowie77@gmail.com 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I am hoping to be more involved. We recently moved back to Palo Alto and I am hoping that I can be of service to the Utility Advisory Commission. John Bowie My background is in law and policy with a specific focus in grid modernization, renewables, demand response, climate mitigation and adaptation, and other regulated industries. My regulatory experience dates back to New York's Hurricane Sandy when I helped lead a coalition intervene to ensure that nearly $2B of ratepayer funds requested to rebuild the distribution grid would enable renewables and distributed resources. In California, I have worked on numerous energy issues, as well as water issues such as potable reuse, managed active recharge, and the Delta Conveyance Project negotiations. Kearns & West, Inc. ✔✔ Consultant, Public Policy and Community Engagement ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV Having been involved in a variety of aspects of utility processes, I love the forward looking nature of CPAU. The City consistently wins awards for its utility initiatives and it's very exciting to think about how I could contribute to that legacy. At the same time, we are confronting a unique moment in the history of utility infrastructure as wildfires are demanding us to reimagine how we build and operate our electric grid. Further compounding the issue, Covid has reshaped our society and drained public coffers. Climate change is creating unprecedented stress on water supplies and biodiversity. It is a daunting moment that we face but I hold a great deal of optimism that we can continue to imagine and innovate new ways through the challenge. I believe that my skills are well suited to the needs of the Utilites Advisory Commission. Having been involved in nonprofits, academic think tanks, and public and private sector companies in the regulated utility space, I can speak to a range of issues. Through these experiences, I have navigated a variety of subject matter issues involving electric utilities, water and groundwater, tech, telecommunications, and hazard mitigation. Finally, having worked as a public engagement professional, I understand the paramount importance of public process and the need to involve diverse voices in decision making. I hope that I can bring these skills into the service of the Utilities Advisory Commission and the people of Palo Alto. John Bowie I drafted the following as part of my fall application, so while not totally recent, it is still relevant. Electric vehicle charging infrastructure is an issue of particular interest that the Commission is contemplating. Combining electric utilities with transportation, GHG reductions, equity issues, and the blossoming electric vehicle industry is a fascinating subject. I think the depth of interest is how charger infrastructure is an essential component to fulfilling the EV transition and meeting climate mandates. The topic of charging infrastructure has received little fanfare compared to the vehicle transition but is absolutely critical to the success of transportation electrification. Charger companies face a variety of issues, such as tight ROIs with ~7-year payback periods on their infrastructure; technical challenges due to operating in an unsettled regulatory space (e.g. the location of charging ports on cars); and a need to build to a battery industry that is advancing at a breakneck pace. As regulators, EV charging infrastructure encompasses all these issues on balance with the public interest - how can a utility advance charging infrastructure in a way that accelerates the industry while also democratizing access to EVs? How can a utility proliferate charging infrastructure to meet new use cases, such as heavy-duty vehicles, electrifying ride share, or electrifying autonomous fleets? As a utility at the heart Silicon Valley, CPAU may be first to address many of these issues. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ If appointed, I would like to see the Utilities Advisory Commission further CPAUs success on climate mitigation efforts. Specifically, the role of utilities in transportation electrification is still being defined. Full decarbonization of our economy depends on advances in how electricity is procured and delivered. In particular, I believe there are creative ways of pricing energy resources, such as geographic time of use rates to complement locational marginal pricing, EV fleet operator public charger commitments, and pilot programs with companies to advance nascent technologies. In addition, I would also like to see CPAU further advance electrification efforts for multi-family housing and otherwise EV-underserved populations. In order to achieve wider goals of decarbonization, utilities must pave paths for these communities to adopt carbon-neutral technologies at affordable rates and convenient times. Equity must be an element of our climate plans looking to the future. There will be particular issues around this as the "air conditioning belt" climbs north due to climate change, and our electric system adapts to greater loads. Dovetailing with electrification efforts to reduce CO2 GHGs, there must also be efforts to reduce or limit natural gas. There are several possible initiatives in this space, including identifying and reducing system leakage (or determining ways to account for it), transitioning existing gas uses to electric, and procuring gas from novel regenerative sources. CPAU is already making progress on these issues and I would love to be a part of that process. John Bowie I do not have specific experience with any of these documents but I have been involved in similar efforts in other jurisdictions. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 John Bowie John Bowie 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQCarol H Guthrie Carol H Guthrie 3061 Bryant St cohgcohg@gmail.com 650.855.9072 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Board Member and Officer for Peninsula Youth Ballet, a 501 (c) (3) not for profit corporation since 2007. - Reformed financial and budgeting systems to restore fiscal continuity and compliance. - Successfully funded and presented full-length ballet productions of The Nutcracker. - Managed logistics for auditions, casting, rehearsals, marketing, ticketing, and performances. Carol H Guthrie Spouse saw the opening and felt my experience was relevant. Chaired the Electricity Consumer's Resource Council (ELCON). First industrial representative elected to NERC Board of Trustees; task force member transforming NERC to ERO under FERC. Developed policies advocating and implementing competition in natural gas transportation and restructuring the vertically integrated electric industry. Negotiated, structured, and drafted long term contracts for commodity supply, services, and tolling arrangements (US $2.8 Billion). Provided subject matter expertise, market and risk analysis, decision analysis and investment guidance for utilities capital investment. Stanford University, Stanford Humanities Center Humanities Research Workshop Manager ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV The majority of my professional life was spent in the energy and natural resources industry. Following early retirement, I accepted a job at the Stanford Humanities Center mentoring advanced graduate students. While I am enjoying my role and becoming reacquainted with the Humanities, I am more aware than most of the challenges facing California, particularly in the Bay Area and its cities, to repair, replace, upgrade and fund its energy and water infrastructure. Immediately following my departure from Chevron I accepted a short-term consulting role to support a nascent group attempting to develop strategies to mitigate portfolio exposure, integrate more renewable energy, and accommodate increasing energy efficiency. Since that time natural events such as wildfires and floods have exacerbated the complex and often competing demands on state and local governments to secure safe, reliable, and renewable energy while ensuring availability of critical commodities such as electricity and water at reasonable rates. Over the course of my career I worked on water rights, dam re-licensing, cogeneration facilities, transmission infrastructure projects for both gas and electricity, and the governing laws and regulations. I believe my experience would be useful in this type of an advisory role. Carol H Guthrie I am interested in better understanding the underlying rationale for the assumptions of declining electricity usage suggested in the FY22 Electric Financial Plan and the relationship between the electric and gas assumptions. In light of the assumed trend to electric households and cars and movement away from natural gas and fossil fuels the demand for flexibility in the electricity system will increase. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ Renewable energy will play a continuing role in utility portfolios, recent events in CA and elsewhere suggest a continued need for some generation reserves with greater flexibility e.g. natural gas generators. PA renewable programs appear aimed at commercial users. I am interested in PA plans to educate and engage retail, household stakeholders in supply, transmission, and distribution issues and programs associated with availability and cost of energy and water. Availability encompasses planning for disruptions such as the utilities and CAISO power outages to manage wildfires and potential longer term impacts on clean water and all infrastructure - gas, water, and electric. In recent years we have experienced numerous unprecedented events which are still being analyzed and understood. While managing recovery from the pandemic and resumption of activities for a "new normal", scenario planning has an important role. I would like to ensure PA does not rely only on traditional resource planning and uses scenario and risk based decision analysis. Carol H Guthrie I have not had experience with PA specific plans; however, throughout my career I engaged in analyzing, commenting and engaging in proceedings through ad hoc advocacy groups on plans such as these with numerous utilities - IOU, municipal and other - at the state and federal level. I managed and planned for the energy requirements for large industrial consumers and generators and commercial consumers of all sizes ranging from large buildings to pump stations, and service stations. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/2/2021 Carol H Guthrie Carol H. Guthrie 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQDonald Clark Jackson Donald Clark Jackson Post Office Box 986, Palo Alto, CA, 94302-0986 dcj+uac-public@clark-communications.com +1.408.395.3516 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I've been a UAC commissioner since June of 2019. I spend a significant amount of time researching many of the issues that come before the UAC. I undertook a leadership role in support of, and advocating for, the CPAU Staff proposal to raise millions of dollars (in a carbon-neutral manner) through REC sales/exchanges, I collaborated with a fellow commissioner and Staff, ultimately both UAC and Council voted unanimously to approve this program. More recently, I authored a detailed list of questions and suggestions regarding systemic obstacles to residential electrification projects due to potentially outdated building codes, which I have shared with the Directors of Planning and CPAU, the UAC, and the public, in preparation for an upcoming UAC agenda discussion on this topic. For the past 3+ years, I’ve worked on a volunteer basis in collaboration with resident T.C. Rindfleisch and Stanford Professor J.J. Alonso on a project to measure, collect, analyze, and report on aircraft traffic and the resulting ground noise, our goals are to provide factual, objective data to inform discussions and debate on this topic. Last year our project was awarded a grant by the FAA to fund student research, and I presented an overview of our work at the 2020 Aviation Noise & Emissions Symposium. Donald Clark Jackson CPAU Email I graduated with a double major in electrical engineering and computer science from Vanderbilt University in 1980, moved to Silicon Valley, worked for a variety of companies, currently semi-retired. I was appointed to fill a vacancy on the UAC in 2019. As a commissioner, I have invested considerable time and effort to educate myself on the topics of electrification, the City’s S/CAP goals, and details of both the electric and fiber utilities. One consequence: I've begun electrifying my own home (in progress), in order to “lead by example”, and I hope to use my experience to benefit the community DriveScale Corporation Computer Engineer/Programmer ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV I’m extremely concerned about climate change, and through my work with the UAC, I’ve learned about the dangers of natural gas, and the need for decarbonization/electrification, and I want to continue to work with Council, Staff, and UAC on our S/CAP goals. I have worked for 40+ years as a Silicon Valley engineer, and I have extensive experience making products and services “happen”, which will continue to be one valuable perspective to have on the UAC, both in general, and specifically in regard to AMI, Fiber, cybersecurity, and electrification projects. I’ve been fascinated with “infrastructure” for many years, initially focused on telecommunications/Internet, and more recently, energy. My interests extend beyond technology and include policy and economics. I’ve submitted comments to the FCC on several issues and am currently working on comments on a FAA noise study. Donald Clark Jackson Generally speaking, at each UAC meeting held since my appointment, there have been one (or more) topics of considerable interest to me, including: • Utility supply planning/agreements (especially electricity and water) • Renewable Energy Credit (REC) exchanges/sales • S/CAP update, goals and process • Extending building “Reach” codes to require electrification • Integration of DERs in Palo Alto • Demand Side Management And many others… Council representatives to the UAC during my tenure (DuBois, Cormack, and Filseth) have direct experience with my preparation, engagement, and passion, not to mention my perfect attendance record, at UAC meetings. An upcoming (April?) topic of great interest is a discussion regarding the impact of the City’s building codes, permitting and inspection processes on residential electrification, PV, and ESS projects. In preparation for that meeting, I authored a detailed list of questions and suggestions for improvement, based on both community input, and my personal experience. I will attach a copy of that document to my application for your reference, as an example of the effort I make on a topic of interest. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ Clearly the UAC’s first and highest priority is to continue to support CPAU and Council maintain, modernize, and improve our existing services (electricity, water, gas). If Palo Alto is to meet our ambitious S/CAP goals, we’ll need to address the electrification of both residences and commercial buildings, including the replacement (over time) of existing natural-gas appliances (water heaters, furnaces, stoves). We need to decide as a community what steps we are actually willing to undertake, and over what timeframe. When I joined the UAC two years ago, I had absolutely no understanding of the environmental impact of natural gas use, and I’m very concerned that the vast majority of residents remain oblivious to this issue, including the costs of electrification. “On-utility-bill” financing of electrification related replacement costs will likely be an important tool. Our building codes and planning processes must be modernized to ease the implementation of electrification projects, in my experience, our current building codes actively discourage and inhibit them. Shelter-in-place due to the Covid-19 pandemic has demonstrated the viability and need for remote work and schooling, but also highlighted the limitations of our existing Internet infrastructure. I hope that the plans and reports resulting from Phase 3 of CPAU’s Fiber Expansion project will give us the context and foundation we need to commit to fiber-to-the-premise for all Palo Alto residents and businesses. Raising the money to undertake this effort will be challenging, taking a bond measure to a public vote may well be required. Donald Clark Jackson I have some familiarity with several of these documents, typically I read/study them on an “as-needed” basis in preparation for related UAC agenda topics. I feel that over the past two years, I have consistently demonstrated my thorough preparation and research for a majority of UAC agenda topics, and that the Council representatives to the UAC over my tenure are in a good position to provide an assessment of my contributions to the entire Council, as you consider me for re-appointment. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 2021-03-07 Donald Clark Jackson Donald Clark Jackson 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQPhil Metz Phil Metz 650-494-6588 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Since 2017 my full-time focus has been environmental sustainability & climate change. In 2020, together with a group of scientists, economists, investment experts and corporate executives, I co-founded the BioPhysical Economics Institute (BPEI). BPEI is a non-partisan non-profit organization working to bring the natural sciences into economic analysis and financial decision making. Especially, BPEI aims to incorporate the analysis of energy into strategies for reducing our reliance on fossil fuels, while supporting our natural habitats. From 2018-2019 I was a Research Fellow at Project Drawdown, geared to helping the world reach “Drawdown” of atmospheric greenhouse gases. Since 2017 I have been a Palo Alto emergency services volunteer (ESV), trained as both a block preparedness coordinator (BPC) and as a community emergency response team (CERT) volunteer. For CPAU, I have participated in 2 Utility Resilience Workshops. Since 2018 I have volunteered as a mentor with the International Rescue Committee (IRC) to help immigrants obtain jobs in the US. Since 2018, I have volunteered with social justice organization Bend the Arc. In the 2020 election I was an active member of Clean Energy for Biden and led a phone banking team in Wisconsin. Phil Metz Education: • PhD in physics • MBA in marketing Experience: • Co-founder and Director, BioPhysical Economics Institute (2020-present) • Research Fellow, Project Drawdown (2018-2019) • 7 years as sustainability consultant and researcher • 10+ years of R&D in energy efficiency and renewable energy, including electric heat pumps, cool / green roofs, solar, and community energy systems • 16 years consulting for energy-related businesses, including electric utilities • 6 years as renewable energy business development executive • 3 years as Palo Alto emergency services volunteer, both as BPC and as CERT BioPhysical Economics Institute ✔ ✔✔ Director ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV My interest in the UAC is applying my experience in biophysical economics, physics, engineering, renewable energy, and building energy systems to help right Palo Alto’s misguided sustainability plans: 1. Improve Palo Alto’s environmental sustainability strategy and impacts. The City relies primarily on remotely generated renewable energy and “Bucket 3” renewable energy certificates (RECs) to “reduce” its GHG emissions. But RECs, as financial instruments, have no energy or GHG impact. The real challenge of renewable energy is delivering electricity when and where it is needed. Bucket 3 RECs pertain to energy delivered somewhere else and at a different time (not necessarily even the same year). As such Bucket 3 RECs do not represent renewable energy used by Palo Alto. In fact, the purchase of such RECs actually retards the transition to renewable electricity (Pinkel & Weinrub 2013) by diverting money from the purchase of real renewable energy delivered where and when it is needed. 2. Use objective biophysical criteria for selecting and evaluating utility plans. I discuss an example, application of energy return on energy investment (EROI) for evaluating Palo Alto’s building electrification plan in #3 below. 3. Improve utility resilience and emergency response. The 2019 and 2020 wildfires and blackouts show how vulnerable the City is to an electricity supply disruption. RECs, as financial instruments, contribute nothing to increase utility resilience or emergency response. Phil Metz The #1 issue I see is providing reliable renewable energy. Over the past year UAC has evaluated PAU’s renewable energy strategy, SCAP, REC exchange, and building electrification. But the core challenge is reliably delivering renewable electricity in the right amount to the right place at the right time. “Financial engineering” via REC exchange, does not address this challenge. And PAU’s strategy of relying on the grid to deliver remotely produced renewables, will increasingly fail the reliability test. CAISO’s analysis of the August 2020 blackouts concluded that “resource planning targets have not kept pace to lead to sufficient resources that can be relied upon to meet demand in the early evening hours”. Make no mistake: Grid reliability will get worse. More frequent heat waves will increase energy demand and reduce supply, even as the grid becomes more renewable – hence more difficult to manage. PAU has fostered residential PV systems and electric vehicles (EVs). But most PV systems cease operation when the grid is down and commercial EVs cannot return stored energy to the grid. So, both are useless when the grid is down, or in an emergency. In short, to deliver reliable renewable energy PAU must be proactive in generating and delivering the renewable energy it needs. We need to develop local renewables as part of a strategy that integrally connects energy generation, delivery, and end use, and that anticipates emergencies. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ The top goals I would like to see UAC achieve are: 1. Deliver “real” renewable energy that matches PAU’s load second-by-second. That means proactively reducing PAU’s dependence on remote renewables and RECs with a holistic strategy that dramatically increases energy efficiency, demand response, and local distributed energy resources. 2. Apply objective biophysical metrics, such as EROI, to PAU energy-related decisions. Building electrification is an example: Jettisoning natural gas distribution in residential neighborhoods by 2030, forcing homeowners to replace still-functional gas-fired equipment with new electrical equipment, could actually increase GHG production (and reduce resilience): The stranded gas equipment and replacement electrical equipment represent large embodied energy – and GHG. It is essential to evaluate the real emissions impact, including these GHG sources, using metrics such as “energy return on energy investment” (EROI). “Scope 3 emissions”, also currently ignored, provide another example. We must “do the math” to ensure that we don’t increase GHG emissions in the name of sustainability. 3. Incorporate resilience and emergency response in utility decision making. With Palo Alto’s complete dependence on an unreliable grid for its electricity supply, resilience needs to be a more important consideration in PAU’s planning. Local renewable energy generation and enhanced building energy conservation warrant deeper exploration. Especially, Palo Alto needs to ensure minimum habitability during an emergency so that residents can safely shelter in place. Phil Metz I am very familiar with the Utilities Strategic Plan, the Long Term Electric Acquisition Plan, and other documents, such as the FY 2019 Electric Utility Financial Plan and Rate Proposal, in connection with my participation in two City of Palo Alto Utilities Advisory Commission Resilience Workshops. I have formally submitted (April 9, 2020) recommendations for improving the SCAP: 1. Greatly enhance community involvement and input in the planning process. 2. Develop a holistic plan that simultaneously addresses GHG reduction, increased resilience, and enhanced emergency response. 3. Close the gaps in transportation and “Scope 3” emissions. Related, I have urged (August 17, 2020) that City Council reject staff recommendations related to the exchange and purchase “Bucket 3” RECs, and instead focus its resources on a renewable energy plan that actually generates renewable energy and reduces energy consumption. That will reduce GHG production, increase resilience, and enhance emergency response. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/5/21 Phil Metz Phil Metz Utilities Advisory Commission Personal Information – Note: The UAC regularly meets the first Wednesday of the month at 4:00 P.M. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Page 1 Utilities Advisory CommissionRajmohan Rajagopalan Rajmohan Rajagopalan Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Utilities Advisory Commission How did you learn about the vacancy on the Utilities Advisory Commission? (Select more than one if applicable) __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Board Member experience at Ecochallenge.org. Member of Kiss The Ground community, focused on reversing climate change. Climate change activist (educating myself and donating time and money to various causes) Rajmohan Rajagopalan Planning to take courses in Foothill college focused on renewable energy, clean tech, regenerative farming. Atlassian 4 4 Vice President/Head of Product Management 4 Page 3 Utility Advisory Commission 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center. (1518 characters) As mentioned above, I'm a climate activist. I own two homes (one in Palo Alto and one in Seattle) that is fully powered by solar panels and drive only electric cars for the last 4 years. I see a ton of opportunity to make an impact in a forward thinking and looking charter city and highly educated and open minded residents of Palo Alto. Rajmohan Rajagopalan Staff Recommendation That the Utilities Advisory Commission Recommend the City Council Approve 10 Year Energy Efficiency Goals for 2022-2031 - https://cityofpaloalto.org/civicax/filebank/documents/80386 This is of particular interest to me, given the progress we need to make to get to carbon neutral by 2050 to reverse the climate change and avoid a climate disaster. If citiies like Palo Alto can't achieve this and act as a role model for California/US and the world, we just dont have any hope we can get to carbon neutral and reverse the climate change. 3.If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 4 Utility Advisory Commission 4.Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (1035 characters) The Utilities Strategic Plan (2018) The Long Term Electric Acquisition Plan (2012) The Gas Utility Long-term Plan (2017) Urban Water Management Plan (2016) Ten-Year Electric Energy Efficiency Plan and Ten-Year Natural Gas Energy Efficiency Plan (2012) Sustainability and Climate Action Plan (SCAP) Fiber-to-the-Premise Master Plan (2015) I'd like to see the commission adopt more forward looking policies and provide incentives to the residents to take responsiblity for their actions, and aware of the role that each and everyone has to play in consuming less (conserve energy, recycle water), producing more (solar and other energy sources). I think the City can have a big impat on how the residents behave and take even more responsibility. Rajmohan Rajagopalan I don't have specific experience. But I love Palo Alto (recently moved from Seattle and setteld here) and I want to contribute my time and energy, skills (tech, growth mindset) to make solid progress in this area. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Utilties Advisory Commission 5.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No 03/22/2021 Rajmohan Rajagopalan Rajmohan Rajagopalan