The URL can be used to link to this page

Home My WebLink About2021-04-19 City Council Agenda PacketCity Council 1 MATERIALS RELATED TO AN ITEM ON THIS AGENDA SUBMITTED TO THE CITY COUNCIL AFTER DISTRIBUTION OF THE AGENDA PACKET ARE AVAILABLE FOR PUBLIC INSPECTION ON THE CITY’S WEBSITE. Monday, April 19, 2021 Special Meeting 5:00 PM Agenda posted according to PAMC Section 2.04.070. Supporting materials are available the City’s website on the Thursday 11 days preceding the meeting. ***BY VIRTUAL TELECONFERENCE ONLY*** CLICK HERE TO JOIN Meeting ID: 362 027 238 Phone:1(669)900-6833 Pursuant to the provisions of California Governor’s Executive Order N-29-20, issued on March 17, 2020, to prevent the spread of Covid-19, this meeting will be held by virtual teleconference only, with no physical location. The meeting will be broadcast on Cable TV Channel 26, live on YouTube at https://www.youtube.com/c/cityofpaloalto, and Midpen Media Center at https://midpenmedia.org. Members of the public who wish to participate by computer or phone can find the instructions at the end of this agenda. To ensure participation in a particular item, we suggest calling in or connecting online 15 minutes before the item you wish to speak on. PUBLIC COMMENT Members of the public may speak to agendized items; up to three minutes per speaker, to be determined by the presiding officer. If you wish to address the Council on any issue that is on this agenda, please complete a speaker request card located on the table at the entrance to the Council Chambers, and deliver it to the City Clerk prior to discussion of the item. You are not required to give your name on the speaker card in order to speak to the Council, but it is very helpful. Public comment may be addressed to the full City Council via email at City.Council@cityofpaloalto.org. TIME ESTIMATES Time estimates are provided as part of the Council's effort to manage its time at Council meetings. Listed times are estimates only and are subject to change at any time, including while the meeting is in progress. The Council reserves the right to use more or less time on any item, to change the order of items and/or to continue items to another meeting. Particular items may be heard before or after the time estimated on the agenda. This may occur in order to best manage the time at a meeting or to adapt to the participation of the public. HEARINGS REQUIRED BY LAW Applicants and/or appellants may have up to ten minutes at the outset of the public discussion to make their remarks and up to three minutes for concluding remarks after other members of the public have spoken. Call to Order Special Orders of the Day 5:00-5:30 PM 1.Presentation by the Midpeninsula Regional Open Space District 1A. Proclamations Honoring Stanford's NCAA National Champion Women's Basketball Team and Head Coach Tara Vanderveer 2.Selection of Applicants to Interview for the Human Relations Commission, Public Art Commission, Storm Water Management Oversight Committee, and the Utilities Advisory Commission 2 April 19, 2021 MATERIALS RELATED TO AN ITEM ON THIS AGENDA SUBMITTED TO THE CITY COUNCIL AFTER DISTRIBUTION OF THE AGENDA PACKET ARE AVAILABLE FOR PUBLIC INSPECTION ON THE CITY’S WEBSITE. Agenda Changes, Additions and Deletions Oral Communications 5:30-5:35 PM Members of the public may speak to any item NOT on the agenda. Council reserves the right to limit the duration of Oral Communications period to 30 minutes. Minutes Approval 5:35-5:40 PM 3.Approval of Action Minutes for the April 5, 2021 City Council Meeting Consent Calendar 5:40-5:45 PM Items will be voted on in one motion unless removed from the calendar by three Council Members. 4.Approval of: 1) Professional Services Agreement With Blue Rhino Studio, Inc. in the Amount of $214,706 for Dinosaur Exhibits for the Junior Museum and Zoo (JMZ); 2) Accept a $14,325 Christopher & Dana Reeve Foundation Grant for Adult Changing Tables at the JMZ; 3) Approve a Budget Amendment in the Capital Improvement Fund; 4) Adopt a Resolution for the Final Naming Recognition for the JMZ; and 5) Approve a License Agreement With Stanford University for Research Space at the JMZ 5.SECOND READING: Adoption of a Park Improvement Ordinance for Renovations at Ramos Park (FIRST READING: March 22, 2021 PASSED 7-0) City Manager Comments 5:45-5:55 PM Action Items Include: Reports of Committees/Commissions, Ordinances and Resolutions, Public Hearings, Reports of Officials, Unfinished Business and Council Matters. 5:55-6:45 PM 6.PUBLIC HEARING / QUASI-JUDICIAL. 640 Fairmede Avenue [20PLN-00203]: Request for Council Approval of a Preliminary Parcel Map With Exceptions to Divide an Existing 23,000 Square Foot Parcel Into two Approximately 11,500 Square Foot Lots, Larger Than the Maximum Allowed by the Zoning Code, to Facilitate Construction of two new Single-family Residences. Environmental Assessment: Exempt per California Environmental Quality Act (CEQA) 15303 and 15061(b)(3). Zoning District: R-1 (Single Family Residential) 6:45-8:45 PM 7.City Council Review of the Sustainability and Climate Action Plan (S/CAP) Update Report; Provide Feedback on Policy Tools; and Direction to Staff to Implement an S/CAP Engagement Strategy for Three S/CAP Engagement Tracks That Includes Outreach to Council, Commissions, and the Community Memo Public Comment Q&A Public Comment Staff Presentation Presentation UPDATED Memo 3 April 19, 2021 MATERIALS RELATED TO AN ITEM ON THIS AGENDA SUBMITTED TO THE CITY COUNCIL AFTER DISTRIBUTION OF THE AGENDA PACKET ARE AVAILABLE FOR PUBLIC INSPECTION ON THE CITY’S WEBSITE. 8:45-10:15 PM 8.Consideration of Actions and Direction to Support Community and Economic Recovery by: 1) Adoption of a Resolution to Extend the City Manager's Authority to Close Portions of University Avenue, California Avenue, and Surrounding Streets for the Uplift Local Streets Program Until September 7, 2021; and 2) Provide Direction to Staff on the Extension, Discontinuance, or Efforts to Develop a Permanent Parklet Program Council Member Questions, Comments and Announcements Members of the public may not speak to the item(s) Adjournment AMERICANS WITH DISABILITY ACT (ADA) Persons with disabilities who require auxiliary aids or services in using City facilities, services or programs or who would like information on the City’s compliance with the Americans with Disabilities Act (ADA) of 1990, may contact (650) 329-2550 (Voice) 24 hours in advance. Public Comment Presentation 4 April 19, 2021 MATERIALS RELATED TO AN ITEM ON THIS AGENDA SUBMITTED TO THE CITY COUNCIL AFTER DISTRIBUTION OF THE AGENDA PACKET ARE AVAILABLE FOR PUBLIC INSPECTION ON THE CITY’S WEBSITE. Public Comment Instructions Members of the Public may provide public comments to teleconference meetings via email, teleconference, or by phone. 1. Written public comments may be submitted by email to city.council@cityofpaloalto.org. 2. Spoken public comments using a computer will be accepted through the teleconference meeting. To address the Council, click on the link below to access a Zoom-based meeting. Please read the following instructions carefully. A. You may download the Zoom client or connect to the meeting in-browser. If using your browser, make sure you are using a current, up-to-date browser: Chrome 30+, Firefox 27+, Microsoft Edge 12+, Safari 7+. Certain functionality may be disabled in older browsers including Internet Explorer. B. You may be asked to enter an email address and name. We request that you identify yourself by name as this will be visible online and will be used to notify you that it is your turn to speak. C. When you wish to speak on an Agenda Item, click on “raise hand.” The Clerk will activate and unmute speakers in turn. Speakers will be notified shortly before they are called to speak. D. When called, please limit your remarks to the time limit allotted. E. A timer will be shown on the computer to help keep track of your comments. 3. Spoken public comments using a smart phone will be accepted through the teleconference meeting. To address the Council, download the Zoom application onto your phone from the Apple App Store or Google Play Store and enter the Meeting ID below. Please follow the instructions B-E above. 4. Spoken public comments using a phone use the telephone number listed below. When you wish to speak on an agenda item hit *9 on your phone so we know that you wish to speak. You will be asked to provide your first and last name before addressing the Council. You will be advised how long you have to speak. When called please limit your remarks to the agenda item and time limit allotted. CLICK HERE TO JOIN Meeting ID: 362 027 238 Phone:1(669)900-6833 5 April 19, 2021 MATERIALS RELATED TO AN ITEM ON THIS AGENDA SUBMITTED TO THE CITY COUNCIL AFTER DISTRIBUTION OF THE AGENDA PACKET ARE AVAILABLE FOR PUBLIC INSPECTION ON THE CITY’S WEBSITE. Additional Information Informational Report City of Palo Alto's Energy Risk Management Report for the First Half of Fiscal Year (FY) 2021 Palo Alto Fire Department Semiannual Performance Report for the First Half of Fiscal Year (FY) 2021 Standing Committee Meetings Sp. Finance Committee Meeting April 20, 2021 Schedule of Meetings Schedule of Meetings Public Letters to Council Set 1 Set 2 CITY OF PALO ALTO OFFICE OF THE CITY CLERK April 19, 2021 The Honorable City Council Palo Alto, California Proclamations Honoring Stanford's NCAA National Champion Women's Basketball Team and Head Coach Tara Vanderveer ATTACHMENTS: • Attachment A: Tara VanDerveer (PDF) • Attachment B: Stanford Women's Basketball Team - 2021 NCAA National Champions (PDF) Department Head: Beth Minor, City Clerk Page 2 Proclamation __________________________ Tom DuBois Mayor HONORING TARA VANDERVEER WHEREAS, Tara VanDerveer has led her teams to three national championships, including this trying and uniquely challenging COVID-19 year of 2021 which saw the team on a road trip of almost ten weeks, playing only 6 real home games; also compiling a remarkable record of 14 NCAA Final Four appearances; 21 NCAA Elite 8 appearances; 27 Sweet 16 appearances; 33 NCAA Tournament appearances and 24 PAC 12/10 championships; and WHEREAS, Tara VanDerveer has been honored by her peers and others associated with women’s basketball by being named National Coach of the Year five times, including this current year; three times named the Naismith Coach of the Year, including this current year and 16 times PAC 12/10 Coach of the Year; and WHEREAS, during the 2020-2021 season, Tara VanDerveer became the winningest women’s basketball coach by surpassing the record held by late Tennessee coach Pat Summitt and finished the season with 1125 career wins, beginning at Idaho and Ohio State and with over 970 of those at Stanford University; and WHEREAS, Tara VanDerveer coached the 1996 US National Team to Olympic Gold going undefeated in 60 games; and WHEREAS, Tara VanDerveer, teacher, motivator and mentor has played an important part in her players’ lives, encouraging and enabling them to succeed wherever their journeys have taken them. She has had 30 of her players go on to play in the WNBA, including 2016 MVP Nneka Ogwumike. She has 21 coaches or women engaged in basketball management to her credit; and WHEREAS, Tara VanDerveer has been an outspoken advocate for equity not only for the young women engaged in her program and in the sport of basketball but for women who aspire to enter the field of coaching. For her work and inspiration in this endeavor, she has been honored by the Women’s Sports Foundation by establishment of the VanDerveer Fund for the Advancement of Women in Coaching. NOW, THEREFORE, I, Tom DuBois, Mayor of the City of Palo Alto on behalf of the entire City Council do hereby recognize and applaud Tara VanDerveer, the Setsuko Ishiyama Director of Women’s Basketball at Stanford University and look forward to her continued success both on and off the court. PRESENTED: April 19, 2021 Proclamation __________________________ Tom DuBois Mayor STANFORD WOMEN’S BASKETBALL TEAM 2021 NCAA NATIONAL CHAMPIONS WHEREAS, the Stanford Women’s Basketball Team overcame the hardships and uncertainties of this COVID-19 pandemic year, spending almost 10 weeks on the road, travelling almost 7500 miles; living out of suitcases in hotels; having only their teammates, coaches and staff as in person contacts and in the end persevered to win the 2021 Women’s National Championship; and WHEREAS, the team captured the PAC 12 season crown; won the PAC 12 tournament and had six of its 12 roster players recognized with PAC 12 honors; and WHEREAS, the team packed their bags once again and traveled to San Antonio, TX where all of the NCAA Women’s Tournament games were played, playing six games in two weeks, in the process breaking the tournament all-time 3-point shot record by scoring on 59 of their attempts; and WHEREAS, as Coach VanDerveer noted, this team was like an orchestra with a different soloist each night. During the tournament each of the 12 rostered players saw playing time in at least two of their six games. Over the course of the tournament eight different Stanford players scored in double figures. Lexie Hull was named to the All-Tournament Team along with teammate and Tournament Most Outstanding Player, Haley Jones; and WHEREAS, throughout the season, the team outpaced its opponents in scoring, field goals attempted and made, 3-point shots attempted and made, free throw percentage, rebounds, assists, steals and blocks. NOW, THEREFORE, I, Tom DuBois, Mayor of the City of Palo Alto on behalf of the entire City Council do hereby recognize and send up a big cheer for the 2020-2021 Stanford Women’s Basketball Team and applaud them for their extraordinary perseverance, resilience and excellence that has brought honor to their team, their university and to our community. PRESENTED TO: Francesca Belibi, Cameron Brink, Agnes Emma-Nnopu, Lacie Hull, Lexie Hull, Alyssa Jerome, Haley Jones, Hannah Jump, Ashten Prechtel, Jana Van Geytenbeek, Kiana Williams, Anna Wilson, Tara VanDerveer, Head Coach, Kate Paye, Associate Head Coach, Katy Steding, Assistant Coach, and Britney Anderson, Assistant Coach. PRESENTED: April 19, 2021 CITY OF PALO ALTO OFFICE OF THE CITY CLERK April 19, 2021 The Honorable City Council Palo Alto, California Selection of Applicants to Interview for the Human Relations Commission, Public Art Commission, Storm Water Management Oversight Committee, and the Utilities Advisory Commission Recommendation Direct Staff to schedule interviews with all selected applicants for scheduled vacancies on the Human Relations Commission (HRC), Public Art Commission (PAC), Storm Water Management Oversight Committee (SWMOC), and the Utilities Advisory Commission (UAC). Discussion A total of 25 applications have been submitted during the Spring 2021 recruitment period. Staff is requesting the City Council select the candidates to be interviewed for: • Three (3) positions on the Human Relations Commission, with three-year terms ending May 31, 2024. • Three (3) positions on the Public Art Commission, with three-year terms ending May 31, 2024. • Four (4) positions on the Storm Water Management Oversight Committee, with four-year terms ending May 31, 2025. • Two (2) positions on the Utilities Advisory Commission, with three-year terms ending May 31, 2024. A date for interviews has been scheduled for Wednesday, April 28, 2021 at 6 P.M. Copies of all applications are attached to this staff report. Background On March 2, 2021, the City Clerk’s Office opened the recruitment for the HRC, PAC, SWMOC, and UAC with an application deadline of Tuesday, April 6, 2021. This recruitment was advertised on the City’s website, social media, and inclusion in the weekly Council Packet GovDelivery e-mail notifications. During the last several recruitments, Council has elected to interview all applicants for respective Boards and Commissions. Applicants Human Relations Commission (Three positions with terms ending May 31, 2024) 1. Sunita de Tourreil (Incumbent) 2. Adriana Eberle Page 2 3. Michelle Kraus 4. Angeli Patel 5. Kaloma Smith (Incumbent) Public Art Commission (Three positions with terms ending May 31, 2024) 1. Shiraaz Bhabha 2. Loren Gordon (Incumbent) 3. Mette Huberman 4. Ian Klaus (Incumbent) 5. Emily Meyer 6. Ben Miyaji (Incumbent) 7. Cleia Muggler 8. Harriet Stern 9. Lisa Waltuch 10. Mark Weiss Storm Water Management Oversight Committee (Four positions with terms ending May 31, 2025) 1. Stephanie MacDonald 2. Hal Mickelson (Incumbent) 3. Dena Mossar (Incumbent) 4. Catherine Perman 5. Bob Wenzlau (Incumbent) Utilities Advisory Commission (Two positions with terms ending May 31, 2024) 1. John Bowie 2. Carol Guthrie 3. Don Jackson (Incumbent) 4. Phil Metz 5. Rajmohan Rajagopalan ATTACHMENTS: • Attachment A: Boards and Commission Applications- Spring 2021 (PDF) Department Head: Beth Minor, City Clerk Page 3 Boards and Commission Applications Spring 2021 Recruitment Human Relations Commission (Three positions with terms ending May 31, 2024) 1. Sunita de Tourreil (Incumbent) 2. Adriana Eberle 3. Michelle Kraus 4. Angeli Patel 5. Kaloma Smith (Incumbent) Public Art Commission (Three positions with terms ending May 31, 2024) 1. Shiraaz Bhabha 2. Loren Gordon (Incumbent) 3. Mette Huberman 4. Ian Klaus (Incumbent) 5. Emily Meyer 6. Ben Miyaji (Incumbent) 7. Cleia Muggler 8. Harriet Stern 9. Lisa Waltuch 10. Mark Weiss Storm Water Management Oversight Committee (Four positions with terms ending May 31, 2025) 1. Stephanie MacDonald 2. Hal Mickelson (Incumbent) 3. Dena Mossar (Incumbent) 4. Catherine Perman 5. Bob Wenzlau (Incumbent) Utilities Advisory Commission (Two positions with terms ending May 31, 2024) 1. John Bowie 2. Carol Guthrie 3. Don Jackson (Incumbent) 4. Phil Metz 5. Rajmohan Rajagopalan +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH sunita@chocolatedividends.org Sunita de Tourreil Sunita de Tourreil Sunita de Tourreil 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ -Commissioner for Human Relations Commission 2020-2021 (replacing Commissioner Lee) -SubCommittee member that reviewed CBDG grants for FY 2021-22 -Hate Crimes Letter to Council 3/2021 -Liaison to PAPD 3/2021- -Liaison to Council Member Khou 3/2021- -Volunteer at Addison Elementary School with Project Cornerstone (social emotional learning) and other activities at Addison and Girls Middle School. -Started attending City Hall Meetings in early 2020. Spoke at one (pre-covid), inquiring about a police incident that I observed. -Trained as a CASA (Court Appointed Special Advocate) in 2005-2006. -Multiple community events through my social enterprise, around educating around supply chains, around using your purchasing choices to bring about change in the world. Sunita de Tourreil MASTERS of SCIENCE, MOLECULAR BIOLOGY AND HUMAN GENETICS Worked at UCSF with dying patients with Creutzfeldt Jakob disease, collaborating with nurses, orderlies, local businesses, doctors, scientists all working together to develop a diagnostic test. Founded and built a business that built diverse community in Palo Alto between 2010 and 2018 (The Chocolate Garage) and addressed bringing transparency, accountability and activism to the cocoa supply chain. Also lead luxury educational trips to the global south, to educate and open minds towards other cultures. Single mom to two kids going to school in Palo Alto. Happy Chocolate Experiences, LLC ✔ Entrepreneur, Travel Expert, Chocolate Expert ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ I am interested in seeing more transparency and accountability around diversity, so that we include more voices, and more compassion in our city policies. I am interested in this as a biracial cisgender woman raising two white identified kids, as a single mom in a culture of white male supremacy. My white kids voices will likely be more listened to, and heard, than their black and brown friends and family members. In addition to raising them to understand their white privilege and then be moved to use that privilege to help protect and give voices to those who aren't being listened to, I want to take part in our local community, as a minority biracial resident of Palo Alto. I have benefited from much of the privilege that is bestowed upon affluent white families, having immigrant parents with graduate degrees and growing up in Canada and getting a graduate degree. I want to be aware of this privilege and use my skills to listen to those who have less voice. I also want to use my immigrant experience to bring a fresh look at our cultural short sightedness and broaden the conversations we are having and the solutions we are considering. Sunita de Tourreil As a non-voting immigrant, I want to take part in civic discussions. I wish to continue to be engaged in my local community, beyond the community building that I did while operating a local curated boutique and tasting room. When Commissioner Lee ran for City Council, and a position opened up, I thought I would see what the position requires and whether it would allow me to bring my skills and experience to the table. My experience working with people, both in a medical setting as well as in a retail setting, and internationally guiding folks through travel experiences in the global south, has made me a very good listener, as well as a good question asker. I have scientific training and a logical mind that can process data and see patterns and understand tricky problems. My empathic focus also means I understand how to bring my heart to the table as well, and work to create community that is warm, welcoming and inclusive for all. I bring the additional perspective of being a citizen to two other countries (Canada and Switzerland), arguably with higher quality of life and stronger community fabric. I also speak English, French and Spanish. My travels as a child and as an adult make me a chameleon, able to fit into multiple kinds of environments. I can move between the communities with the fewest resources in Palo Alto and the communities of greatest affluence, bringing an authentic presence to both, perhaps the perfect marriage of my Swiss dad and South Indian mom. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW n/a Sunita de Tourreil I would really like to see the HRC build bridges between the Palo Alto community, and the city government: ie. City Council, City Staff, various commissions and Police and Fire Department. I think that our local community and city government would benefit from more engagement, more awareness, more empathy and understanding of each other, and that together we can build a stronger, more engaged and compassionate Palo Alto. I believe more community engagement, and awareness raising around racial equity, as well as the plight of vehicle dwellers struggling to find permanent housing in one of the most expensive cities in the country, will go a long way to finding a broader willingness for our community to engage in meaningful ways, and be part of the solution. I think Palo Alto can take a more honest look at its history and where it has failed to be better, and strive to make amends and repair the harm of decades of systemic policies that have kept Palo Alto lagging not leading. I think that finding ways to inspire and educate our community, helping folks soften their hearts and nurture empathy, to understand the human stories behind our marginalized communities, will go a long way to transforming Palo Alto into a city where people of all socioeconomic and racial groups feel a sense of belonging. We have already raised awareness with the Chair and Vice Chair's work documenting black and brown stories in our communities. Now we must keep the community conversations going and continue to raise awareness, inspiring our members to get more engaged. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 04/06/2021 Sunita de Tourreil Sunita de Tourreil +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH liederseberle@gmail.com Adriana Lieders Eberle Adriana Lieders Eberle 688 Main St. Redwood City, CA 94063 adriana@eberlaw.com 650-461-9066 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+LVWRULF5HVRXUFHV%RDUG" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ Community Legal Services in East Palo Alto (2014-2015) provided legal advice and counseled clients facing eviction. Ohlone Elementary School: Co-Chair of the school's biennial auction (2017 and 2019) - Organized a live and silent auction. Site Council (August 2012 – May 2014)- Member of a three person team that designed and implemented a climate survey to the school’s staff, parents, and students. Parent Teacher Association (PTA) Executive Board (Historian- August 2013 – May 2015)- Liaison to several sub-committees including special education. Chair of the PTA Nominating Committee (February 2014 – May 2014) - Responsible for identifying and recruiting volunteers for key leadership roles. PAUSD: Member of PiE (2019-2020) JLS Middle School: Member of the Connections Board (June 2020- Present) Palo Alto High School: Co-lead of the Class of 2024 Parent Network (August 2020- Present) Parents Nursery School, Palo Alto, CA - School co-president for the 2012-2013 school year. Adriana Lieders Eberle Instagram Post The Law Offices of Adriana L. Eberle (December 2015- Present): Member of the Private Defender Panel in San Mateo County. The San Mateo County Private Defender Program is the sole provider of indigent defense in San Mateo County. Deputy District Attorney positions: Office of the District Attorney in San Mateo County (Volunteer, August 2015 to December 2015) Office of the Commonwealth's Attorney in Loudoun County, VA (April 2005- June 2010) Office of the Commonwealth's Attorney in Fairfax County, VA (January 2002- April 2005) Georgetown University Law Center (J.D. 2001) and Syracuse University (B.A. 1998) Self-Employed Owner - The Law Offices of Adriana L. Eberle ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ As a former prosecutor and presently, a criminal defense attorney, I am very interested in police brutality and systemic racism in policing. Last Spring the Commission tackled the issue of police brutality as thousands of protesters took to the streets of Palo Alto to demonstrate against the police. Calls to defund the police were heard all across the country. Based on community input the Commission acted swiftly and made several recommendations to City Council regarding police funding, hiring, and policies. As a witness to systemic racism in the criminal justice system, be it the police, probation officers, zealous prosecutors, or judges, I have strong insight into this system. I have worked on both sides and have an in-depth knowledge of its inner workings and how to affect change. I have a life long interest in these issues and would love the opportunity to utilize my knowledge in order to make this a more just city. Adriana Lieders Eberle First and foremost I would like to serve on the Human Relations Commission because I love Palo Alto. My family and I moved to California in August 2010 and quickly realized we wanted to relocate to Palo Alto, and so we did, in January 2011. Growing up in Brazil and living in several cities on the East Coast has given me an unique perspective as to the challenges facing Palo Alto and what its strengths and weaknesses are. I have two children in the school district, a 6th grader and 9th grader who have gone through the Palo Alto public school system. I have been a stay-at-home mother and a working mother. I have been a renter in Palo Alto, and now a home owner. Personally I would bring to the commission a diverse background with deep ties to this community. Professionally I have been a prosecutor and now a defense attorney who specializes in indigent defense. I have extensive experience in speaking with and defending people of all backgrounds, including the most vulnerable. People who have been systemically discriminated against and who have absolutely nobody to support them. I also have experience training and working with police officers, community advocates, and crime victims. As I have been on both sides of the justice system I would bring a balanced and analytical approach to the Board. Because of my profession as a lawyer I also bring to the table a deep understanding of legal policy and procedure. I have extensive experience analyzing statues and municipal codes and applying them. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW Although I don't have personal experience with these documents besides reading them, I was previously made aware of the landlord-tenant dispute resolution process through one of my friend's experiences with her landlord. Adriana Lieders Eberle The Covid pandemic has been a rude awakening to the city. One doesn't need to spend much time on social media to see that the city is suffering and its citizens are deeply divided. I am extremely concerned about Palo Alto's future. The rate of hate crimes is on the rise in Palo Alto and across the country. I understand that the Commission has started working on this issue, and I applaud them for that. I believe that my background would be helpful in understanding the law, analyzing it and offering guidance to the City. Given my profession I am also experienced in engaging with people from all walks of life and look forward to putting my skills to good use as a member of the Commission. The Pandemic has also exacerbated some issues that have been simmering all along - social and economic inequality, housing, and racial justice. I would like to see the commission tackle these issues head on. What kind of city do we envision Palo Alto to be 20-30 years from now? Palo Alto is the birthplace of Silicon Valley and a hub of innovation, we should bring cutting edge and innovative strategies to City Council. The post-pandemic roadmap will be unlike anything we have witnessed within our lifetimes. Let's take this opportunity to create a city that doesn't only talk about issues but actually implements change for the betterment of all its citizens. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 04/05/201 Adriana Lieders Eberle Adriana L. Eberle +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH michellekraus@yahoo.com Michelle Kraus, PhD Michelle Kraus, PhD PO BOX 116, Palo Alto, CA 94302 650-218-5540 michellekraus@yahoo.com 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ Involvement in Affordable Housing, Rent Control issues, Clean Tech as a volunteer and long term renter (since arrival in PA in 1998 excluding period in Menlo Park) Co-founded early Clean Tech Company dedicated to the work on pricing carbon. Spoke in the community and wrote articles that were published nationally. I have participated/developed/managed grassroots political activities at the local, regional and national level since 2002. I have coordinated events on progressive issues, grassroots fundraisers and national issues -- women, AAPI, and other special and ethnic issues as a national co-chair of John Kerry for President; as a Finance Committee member of Hillary for President; as Member of the National Fundraising Committee for Obama for President; and as a Founding Member of Biden for President’s Innovation Committee, Women’s Group and the National Finance Committee. Helped to found, run and serve on the community-wide Blue Ribbon Climate Task Force for Menlo Park (1998 to 2008) Helped to re-establish the AAPI community in the Democratic Party (community wide and national 2002 thru 2005).Participated and often led community-wide events. Overall, I’ve worked on women’s issues in the workforce all of my adult life.പ Michelle Kraus, PhD BA and MA in American Culture (study of cultural and sociological trends in the US) Certificate for Women's Studies (one of the first granted at Douglass College, Rutgers University) Studies at Eagleton Institute, Douglass College (study of women, trends, and policies) Writings published in the Huffington Post on politics, policy for over a decade. Writings published in Forest and Trees (a leading Progressive blog) on progressive politics Overall, working with many women, social causes and climate change organizations over the decades. Technology & Politics ✔ Tech Exec, Expert, and Crisis Consultant ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ The issue of hate crimes was discussed in the February and March meetings. There were disputes among the Commissioners, and perhaps some resolutions because of urgency. I suggest that the Commission draft (if they have not already done so) a public statement to be adopted by the Palo Alto City Council from which city-wide policies flow. This should be the umbrella policy statement under which the City operates. It is important to make this public as community-wide talking sessions are developed to coordinate actions. This is not a time to defer or be silent. Hate and hate speak must be removed, and citizens need to see the City has a Commission that is taking action. 1. Improve the messaging and communication vehicles on specific policies and tactics taken concerning prejudice and hate in the City of Palo Alto. I have a life-long commitment to social change having grown up in an ethnically and racially diverse small town outside of New York City -- in the shadow of the race riots of the 1960's watching as neighborhoods in Newark, New Jersey was burned down to the ground. The bridges were turned to stop the rioters from accessing the white working and middle class towns -- not very different during the Rodney King race riots when I lived in Santa Monica, California though in California we were closer and heard the shots and the sirens. These life experiences often change people for the good, and sometimes for the bad. For me, it helped shape my activism to change the system. For me, it was a pathway of study, understanding and activism. I've written, I've lectured, I’ve researched, I've spoken and I've helped form new groups to affect change. This is basket full of tools that I will bring to the Human Relations Committee and a hunger to get things done. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW 1. Improve the messaging and communication vehicles on specific policies and tactics taken concerning prejudice and hate in the City of Palo Alto. 2. Develop community-based 'talking sessions,' and offer training on the methodologies of engagement to open up discussion. I know that this is a very engaged populace, yet it leaves many out of the discussion. 3. Continue the work on affordable housing, rent control and rent abatement. 4. Review the work already done on health care equity. Public health care and policies are critical at this point in time. 5. Continue to coordinate with the County. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Michelle Kraus, PhD Michelle Kraus +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH n/a Angeli Patel Angeli Patel 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+LVWRULF5HVRXUFHV%RDUG" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ --Constitutional Police Reform (11/2020-Present): Ongoing legal research and advice about police reform to LAPD through law firm pro bono project; previous research include reforming Stop policies and diversifying community outreach programs. --The Warmth Project (11/2020-1/2021): Founder; Provided 120 warm mac n' cheese and chicken wings meals to the unhoused community in Oakland for the holidays by raising money through social media. --Let's Talk (6/2020-7/2020): Organized 100+ South Asian people online of different ages to discuss ant-blackness and racism in the community in the wake of the BLM protests; see https://bit.ly/3wfLkRO. --Bet Tzedek Unemployment Law Pro Bono (4/2020-5/2020): Provided pro bono legal advice to LA residents in the wake of unemployment crisis during COVID-19. --Berkeley Small Business Pro Bono program (3/2020-5/2020): Provided small businesses legal advice pertaining to PPP loans and how to navigate government resources for COVID-19 relief. --Agents of Change (8/2018-6/2019; Board member): non-profit empowering high school students to engage in civic activism; helped incorporate the non-profit. Angeli Patel California Bar Association South Asian Bar Association J.D. UC Berkeley School of Law B.S. International Affairs, Georgia Institute of Technology Jones Day ✔ Attorney ✔ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ I was fascinated by the 8CantWait discussion because it aligns well with my recent organizing efforts and my work at the law firm. When I mentioned that all change is local, this priority area is where it is most applicable. Many cities are struggling to make necessary changes on police reform and the broader context of engaging the community on difficult topics like racism and hate. I have been working with Vice Chair Stinger to train 100 leaders for anti-racism and developing a discussion guide for it. This topic is important to me because racism and hate has started to tear relationships apart. Without government and community leadership, I worry that it will only get worse. 8Can'tWait is a great start to creating a safer community for people of color. But more can be done to address racism in Palo Alto. With my experience organizing communities, I know that engagement is 75% of work towards inclusion. Getting people to engage with their city and neighbors activates awareness. I would work with the HRC to develop a robust engagement strategy on this topic that meets Palo Alto residents where they're at. Angeli Patel I am inspired by the Human Relations Commission (HRC) because I am a product of a strong community myself. Growing up in rural Georgia in a poor family, I relied on having a strong community that cared to invest in me. From teachers that cared about what was happening at home to businesses that opened their doors for a job-- a strong community meant that each person was engaged in your wellbeing. I want to join HRC because it has the power to set the ethos of our community and keep it strong, especially in these trying times. ALL changes starts local and urgent. That is why I want to get involved now. My experience helping the HRC organize discussions about racism in the community, organizing the South Asian community remotely across various cities, and being on the ground providing meals to the houseless community among other listed above, have prepared me to serve. Each experience highlights my ability organize myself, my thoughts and people around a mission. It also means I can put my head down and do the work of writing and project managing. In addition, as a lawyer, I stay engaged in matters that are relevant to the community through the pro bono practice. Finally, I have served on two boards for non-profits which has taught me how to make the most impact with the least funding. Finally, I have a background in design and social media which have made it easy to scale community projects. 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW I do not have experience with these documents specifically, but I have experience navigating municipal codes and city regulations. I have also partially read through the Human Services section of the Comprehensive Plan. On a side note, I wanted to mention that I believe any group is only as effective as the team members who are a part of it. I have always valued working cohesively, getting to know different opinions and creating spaces where differences are an asset to executing a vision. If selected to serve, I will bring a mindset of collaboration first. It is a core value for me to be efficient and harmonious. Under the leadership of the Chair, I believe my listening-first and open personality can be an asset to the Commission. Angeli Patel Organizationally, develop an achievable plan for each issue priority identified in the Jan and Feb meetings and post it online (or share internally). This would help the HRC be transparent and have something to work towards; Reserve 5 minutes on the agenda for a creativity brainstorm that could be open to the public; meet each Commission member for one-on-one coffee to build bonds within the Commission. For anti-racism, help train 100 leaders on anti-racism and learn from it to develop a recurring training on anti-racism that local leaders, small business owners, and individuals can take and get a "HRC Trained" certificate. Create a model "truth and reconciliation" mediation guide to be made available to the public as the first of its kind in the nation to address the hate crimes happening around the city. I can draft, research, and find experts to inform both processes. For efficiency, instead of only HRC taking on solving complex community problems, we could host a Silicon Valley-style incubator for community members to participate and pitch their solution (similar to a pitch competition but a social hackathon). I can organize. Idealistically, connect small businesses and unemployed people. I would organize a small business hiring fair that can be replicated yearly to help fill vacancies and get people jobs. This would be subject the HRC's priorities. I could also start a "Humans of New York" style monthly short blog that highlights a quick quote from a random community member and share it on social media/website. This would engage people more to the HRC and each other. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Angeli Patel Angeli Patel ANGELI PATEL 734 Webster Street, Apt. C • Palo Alto, CA 94301 • (478) 484-1762 • angelip92@gmail.com EDUCATION University of California, Berkeley, School of Law, Berkeley, CA Degree: J.D., May 2020 Activities: Women and Tech Law (Board Member); Berkeley Technology Law Journal (Editor); Berkeley Information Privacy Law Association (Vice President); Prisoner’s Advocacy Network Bar Status: California, 2020 Georgia Institute of Technology, Atlanta, GA Degree: B.S., International Affairs, May 2014 (focus on cybersecurity and European Union) Honors: Ivan Allen Jr. Legacy Award (for leading social change and achieving excellence in international studies); Woodrow Wilson School Fellow, Princeton University (for foreign relations, technology and counter-terrorism); National Science Foundation Scholar for Service (for cybersecurity and government critical infrastructure). Activities: Founder of Rethink Disabilities Awareness EXPERIENCE Jones Day – Palo Alto, CA November 2020 – Present Associate Experienced in corporate and energy law. Drafting, research and reviewing hundreds of pages of contracts and documents to aid in corporate transactions as well as litigation. Involved in the Constitutional Police Reform project to aid LAPD in their policy reform. Summer Associate May 2019 – August 2019 Analyzed and wrote a brief for the significance of excluding choice of law provisions in contracts. Synthesized feedback from partners and clients to incorporate legal strategy into the work product. Presented research on dual-class stock structures to the all Jones Day corporate attorneys in the Northern California region. Trained in groups for depositions and negotiations strategy. Aided in filing for NYSE disclosures for foreign private issuers and updates to 10-K for publicly listed clients. UN Global Compact Network Australia – Melbourne, Australia September 2019 – December 2019 Associate Helped identify strategic opportunities to engage with government, private companies, civil society and community stakeholders. Gathered external feedback from and documented engagement strategies with industry players, experts, academics, advocacy groups, think tanks, and governmental and civil society. Wrote proposals to the Senate on labor, sustainability and climate change policy. Wrote briefs, talking points and concept notes for corporate executives and government leaders for the National Dialogues on Anti-Corruptions and Bribery and Business and Human Rights. Drafting a short paper on the role of stock exchanges and self-regulating organizations under the stakeholder primacy model. Synopsys – Mountain View, CA May 2018 – August 2018 Legal Intern $3 billion electric Design automation company. Assisted with the due diligence review of documents in M&A transactions. Assisted in drafting memorandums and analyses relating to IP law and corporate governance issues. Researched new regulations and changes to legislation, and collected precedents and assisted with transaction management. Government of Chile – Ministry of Finance – Santiago, Chile May 2017 – August 2017 Policy Advisor Presented policy proposal to Ministry leadership to fund user satisfaction research, which led to the creation of an office dedicated to user satisfaction research. Persuaded leadership to send diplomats to the UK to learn more about Open Data portals and how the Chilean government can benefit from international examples. Drafted memoranda to agency leadership on topics such as open data, fiscal transparency, user experience, public trust and digital government. The White House – Office of Management and Budget – Washington, D.C. December 2015 – January 2017 Chief of Staff Served as proxy for the Deputy Director when interfacing with high-level stakeholders in industry, labor and Congress. Developed tools and metrics for measuring the impact of internal engagement in our organizational structure. Managed 300 employees in a fast-paced environment focused on drafting $3.6 trillion U.S. Budget for Congressional approval. Synthesized results from stakeholder engagement and incorporated critical outside perspectives to inform our policy. Advised Deputy Director for Management on policy including government contracting, cybersecurity, open data, privacy, and hiring practices. Wrote talking points and memorandums for White House leadership explaining policy progress and implications. Communications Intern May 2014 – August 2014 Vetted organizations and individuals meeting with the President using agency-specific and public databases. Researched and compiled information on counterterrorism efforts, immigration reform, and international nuclear nonproliferation activities. Monitored full-time media 12 hours a day for the White House, alerting aides of media response to the President’s daily activities. U.S. Department of Health and Human Services – Office of the Chief Privacy Officer March 2015 – December 2015 Privacy and Security Policy Analyst – Washington, D.C. Managed project with 6 U.S. Governors and other state level stakeholders to produce a state-wide strategy for health data interoperability. Gathered external feedback from Governors of each state and documented engagement strategies and guided the development of state-level interoperability roadmaps. Led team of 10 to create a long-term strategy to reduce public perception of privacy/security as a barrier to interoperable exchange of health data. ADDITIONAL INFORMATION Languages: Gujarati & Hindi (Native), Urdu (Speaking), Spanish (Beginner) Interests: Travel (26 countries), fiction book club, event planning, Bollywood Hip Hop, vegan cooking Skills: Writing, digital design, public speaking, PowerPoint presentations, stakeholder management, social media engagement Publications: Magic in the Shower (See Also Literary Journal at Berkeley Law); Google: Do no evil or do the right thing? (Berkeley Business in Society Institute Corporate Sustainability Blog) +XPDQ5HODWLRQV&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Kaloma A. Smith Kaloma A. Smith 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVLQFOXGLQJ GDWHVDQGDQ\RIILFHVKHOGFKDUDFWHUV +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH+XPDQ5HODWLRQV&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ See attached Kaloma A. Smith I currently serve on the commission See attached University AME Zion Church Pastor 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest WR\RXand describe why you are interested in it.$UFKLYHGYLGHRVDYDLODEOHIURPWKH0LGSHQ 0HGLD&HQWHUFKDUDFWHUV 1. WK\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH+XPDQ5HODWLRQV&RPPLVVLRQ DQGZKDWH[SHULHQFH ZRXOG\RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ See attached See attached 4.+XPDQ5HODWLRQV&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RXKDYHH[SHULHQFH 3. If \RXDUHappointed, what specific goals would you like to see the +XPDQ5HODWLRQV&RPPLVVLRQ DFKLHYHandKRZ would you KHOSLQWKHSURFHVV?FKDUDFWHUV ZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKHVHGRFXPHQWVLV QRWUHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHERDUGFKDUDFWHUV 0XQL&RGH±0DQGDWRU\5HVSRQVH3URJUDP &RPPXQLW\6HUYLFHV(OHPHQWRIWKH&RPSUHKHQVLYH3ODQ 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ +XPDQ6HUYLFHV1HHGV$VVHVVPHQW See attached See attached 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3DJH +XPDQ5HODWLRQV&RPPLVVLRQ 4/6/2021 Kaloma A. Smith Kaloma A. Smith List relevant education, training, experience, certificates of training, licenses, or professional registration: I have a wide range of experience and training that I feel would make me very useful in the role. Here is a brief synopsis of relevant leadership experiences: 1.I have successfully led the HRC as the chair in a challenging time. Under my leadership, we have addressed Policing, Housing, Race, and Hate crimes in significant ways. 2.I have successfully led the University A.M.E. Zion Church through a significant transformation and growth. When I arrived five years ago, our congregation was down to 19 active members, black and seniors. Today we have grown to 250 active participants, and we are now a multicultural church with an average age of 32. 3.I have completed the required course of study and educational training necessary for the African Methodist Episcopal Zion Church's ordination. The ordination criteria are eight years of denominational research and formal schooling. This training included a focus on community building, interpersonal conflict resolution, and more. 4.Currently enrolled in a Master of Divinity at Wesley Seminary. 5.I have been selected to be part of the Next Generation Leadership Cohort of World Methodist Evangelism is part of the World Methodist Council, which represent 82 million people from 133 countries. 6.I serve on the board of Manzanita Works 7.I received the Supervisor Award from the County of Santa Clara in February 2020 for my work in Social Justice Describe your involvement in community activities, volunteer and civic organizations: I am currently the Senior Pastor of the University A.M.E. Zion Church, the oldest black church in the city of Palo Alto; this role has allowed me to connect with a wide range of community leaders to be at the forefront of community dialogue around many issues. In the past eight years, I have led or participated in several initiatives in our community: Covid Vaccination Site: University is currently one of the few COVID vaccination sites in North County. We vaccinated 370 individuals on the first day and planned to try and vaccinate more than 1000 individuals on our next date. Community Open Forums on Race in America: After the tragic shootings at Mother Emmanuel A.M.E. Church in Charleston, SC, there was a significant community outpouring of concern about race and where we move from here. We held several community forums, which each had over 150 people in attendance. These forums allowed us to discuss race and equality in our community and our country as a whole. We executed three significant initiatives out of these community forums; the first was the Community Unity Fair at Cubberley Community Center. We partnered with the city of Palo Alto and several local religious and civic organizations to hold a community fair that had children of different racial, ethnic, and religious backgrounds coming together to have fun. The goal was to create a space that would allow children to meet others from different backgrounds and let them see that we are all the same. The second was viewing and discussing the movie. Church. This movie dealt with white privilege and its impact on racism and implicit bias and how it impacts Palo Alto. The discussion was lively and cathartic. The third activity was a community book club that read the book "The New Jim Crow." It was a thought-provoking and compelling dialogue dealing with mass incarceration and how it impacts our communities. I have also partnered with the Human Relations Committee to plan two initiatives in 2016 and 2017 named "Being Different Together." The original 2016 was a panel discussion and forum held at the Mitchell Park Library. I was part of the planning team, along with being the moderator for that event. This event was a great success and well attended; it sparked us to ask how we could continue the positive momentum and equip community leaders with tools to address implicit bias? In 2017 we planned a 4 part Being Different Together." We worked with Dr. Joseph Brown from Stanford University to bring the implicit bias training that Stanford developed to the Palo Alto community. We were intentionally inviting and encouraged persons from varied perspectives to be part of this community dialogue. It was terrific to have so many different views in the room. It made the discussion more meaningful and authentic. This initiative was a great success because of the positive community response. It also allowed people to reflect their implicit bias, and it equipped them with tools to take back to their various constituencies. I have also been active in promoting and developing ecumenical and interfaith connections in Palo Alto. Under my leadership, the University A.M.E. Zion Church has led our community in several activities to encourage religious tolerance. One of our events was sponsoring the 2016 Multifaith Peace Walk and Picnic to remember 9/11. The Multifaith Peace Walk started at Congregation Etz Chayim/Spark Church. It went to University Church, followed by walking to Our Lady of the Rosary Catholic Church, and concluded with American Muslim Voice hosted Peace Picnic at Mitchell Park. Each of the stops put together a brief presentation on how we can achieve peace in our society. The march was a fantastic show of solidarity in our community with over 700 participants and over 35 community faith and civic organization represented, including the Chief of Police from the city of Palo Alto. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? Building healthy and sustainable communities is one of my passions. Whether it is in my role as Senior Pastor at University or in the Palo Alto community, I desire to build bridges and give all stakeholders a voice equitably and efficiently. I believe this lines up with the stated purpose of the Human Relations Commission of fostering public awareness and understanding of human relations by any means. I believe the first step in any movement forward or reconciliation is an open dialogue, and it will foster compassion and communication for all parties involved. We live in tough times, and I believe for Palo Alto to be a healthy and dynamic city, the work of the Human Relations Commission is vital. People in the community need to know a place where they can speak on complicated and nuanced issues we face today. I believe this more today than when I started my first term on the HRC Please describe an issue that recently came before the Commission that is of particular interest and explains why you are interested in it? I am highly interested in all the items on the current work plan for the HRC. I believe that each of the three elements of Equity and Belonging, Homelessness and Housing Insecurity and Mental Health and Wellness are critical areas we need to focus on moving forward. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? Please see the current HRC work plan. Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursdays of the month at 7:00 P.M......... Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Public Art Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Shiraaz Bhabha Shiraaz Bhabha shiraaz@shiraaz.com I would love to see Public Art as the centerpiece in our community where the city provides a backdrop to all the changing artwork and projects. The art can be visual, like images, sculpture and installations or interactive to include and engage the viewer. It is exciting to expand to other mediums like digital media, performance art and literature exhibits (poetry, storytelling, etc.). I would also engage and collaborate with neighboring communities, as it is a great way to foster connection within the art collective and create a wider, more inclusive community as well as encourage more art all over the Bay Area. With the success of locally headquartered companies, I think there is an opportunity to augment city funding with corporate contributions to Public Art. I think art has a potential to bring attention to social justice and environmental issues. It can help us see a different perspective, gain new knowledge or initiate discussions to understand and empathize with other viewpoints. Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Public Art Commission How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Program manager, Volunteer artist and Fundraiser for the Kids & Art Foundation. Managed and coordinated the Lucile Packard Children's Hospital workshops and the Indigogo fundraising campaign that raised over $25,000. Also volunteered as an artist at the workshops. Motivated by a shortage of preschool openings, I co-founded Slippery Fish, a cooperative preschool, with 3 partners to provide social engagement and learning opportunities for a group of neighborhood children. Slippery Fish is now a First Five San Francisco Excellence Award winning cooperative preschool. Volunteered at Palo Verde elementary school (noon art, room parent, event organization like book fairs, etc.). Artist for the Palo Alto BLM mural in 2020. Currently a Microgrants Selection Panelist for the Palo Alto ArtLift Microgranting Project. Shiraaz Bhabha - BFA in Commercial Art - MFA in Computer Art - Painter/Artist - Graphic artist and user experience designer for multiple silicon valley companies - Freelance photographer - Spectra art teacher at PAUSD PAUSD 4 Spectra Art Teacher 4 Page 3 Public Art Commission 2.Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) 1.Why are you interested in serving on the Public Art Commission and what experience would you bring to the position? (1518 characters) Public Art Commission March 18th, 2021 https://www.youtube.com/watch?v=EJ2mwbY3sL0&t=5s I have a particular interest in the initiative of the Arts Commission and the Human Relations Commission to create a permanent platform for temporary art that focuses on promoting diversity and racial justice. Having this platform can create opportunities to raise and promote awareness on various issues we face today as a society. The temporary nature will allow us to cover a variety of important topics. The permanent platform will keep a focus on these issues. We can highlight several issues such as racism, gender injustice, refugee crisis, income inequality, gun violence, ageism, human rights, etc. Being an immigrant American myself and given all the recent events, I have been thinking about this initiative a lot recently. I am excited to see the commission taking action on this already and would love to contribute to it. Participating in the Microgrants Selection Panel and working as an artist on the BLM mural helped me realize the amazing things being done with the arts in our community. I believe Public Art can become the community nucleus that brings people together by engaging and involving them, while making our neighborhood more vibrant and beautiful. It humanizes the built environment and enhances public spaces. It adds meaning to our city and uniqueness to our community. It also creates important conversations and builds a stronger community, especially during this time, when there are so many polarizing opinions. As a Palo Alto resident who is passionate about this community, I would love to bring more art into the public space, and create memorable experiences for everyone. I would advocate and involve people of all ages, from the youth to seniors. I want to increase engagement through outreach in schools, senior communities, local social media groups, art organizations, city departments and the like. I think the commission's excellent work in involving local business and community organizations has been very effective and should be continued. I have spent most of my life around art, from painting, digital art to photography. I started teaching art at our local elementary school a couple of years ago. I intrinsically understand the importance of art - creating it, encouraging it, fostering it, and being surrounded by it. Page 4 Public Art Commission 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan 3.If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) I do not have any prior experience with this document. However I have studied the document carefully and that has got me even more excited about the opportunity to work with the commission and help make a difference. I would love to see Public Art as the centerpiece in our community where the city provides a backdrop to all the changing artwork and projects. The art can be visual, like images, sculpture and installations or interactive to include and engage the viewer. It is exciting to expand to other mediums like digital media, performance art and literature exhibits (poetry, storytelling, etc.). I would also engage and collaborate with neighboring communities, as it is a great way to foster connection within the art collective and create a wider, more inclusive community as well as encourage more art all over the Bay Area. With the success of locally headquartered companies, I think there is an opportunity to augment city funding with corporate contributions to Public Art. I think art has a potential to bring attention to social justice and environmental issues. It can help us see a different perspective, gain new knowledge or initiate discussions to understand and empathize with other viewpoints. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Public Art Commission 5.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No April 5 2021 Shiraaz Bhabha Shiraaz Bhabha 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Loren K Gordon Loren K Gordon 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU 5 "'" +%'" &&"!%3 +%%!'/-"%-'!"'%%'" &&"!%!' + !("!&" &&"!'"'%" +!'/!#+'"%!%(&'%&!/%&+(!!' %("!!!&'("!"!%'-"%"+&"!%2$+'/!!+&"!"! ! 04 , &"!!,",-''+(&"'" &&"!!+!%(&'&("!2-"%!"!&'"% ' +%2%,-!'!-&'%'#!"%"%!,!+2!"'%.(!#%"'& !&+##"%'"#+%'4 5"/&!%&+"' !!&+3#-'""#%#%("!!&'%+("!4 5"+!'%-'$+.!'"%!%%#%"+'&'" %'!"%%'"!&+%'' & % %&%,%!" 4&"!+&#%" "(!!&!%'%#%"+'&4 5%,"!'.+(," *"+ !'&'"!/4&!,",&!! "+%" +!'/!'#%"% &"2!+!%&!"%'!/4 5 !!&+%+(("!%, %3% ",'%&%" #+%&2#!' !!"+&#!'&2%"%#!'%&!!"%""&4 Loren K Gordon !$ &''+/./&!$ &''',*** ! & !! # $ '! # ! "$ &,*+-(,*+.' & $! ' 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV ""'!'#!##'!#")"##('# '##'-!"""-"-'$##(!#! '!"##"!!!"##!*!-'"#!!. #'!#""!#*!! '#*"'##+#.# ('##'!"""!&!'"!$"#"!$"#"!- !#"'!(*!$"#".!(#"'!(*!"'#"!##)(* !#'$"#!( '#*""#'!#!!.#!"#! )#!'!!$"#"-)###!!#"*!"- #!"#*(!"!$"#"!#*!*. ""!### '")("#"#!#)! +.")## ("&! '!-)!"""#!#!!#)!$"#"#*.(! ###!"#'"#)*#!'## '!$"#". !'%&'!"!(!+!'-"%"'+%'" &&"!!""%("!-'' + !("!&" &&"!4 '/"+!&&'+%'" &&"!'","# #% !!'%'-"%"+&"!%2$+'/!!+&"!"!!0''/4!"%%'" *%+!%&'!"-#"#-",2-"%!,&'"'""+'"!!!'&'/2 '&%('"-"%-''4 .#%!,!/""%(!-'' -!''&#%"'4 -&"!'" &&"!-!'+%' &'%!-&%'2! "%%!'/' ,&'%'+%'!4 .''""!(!+-"%!"!' # !'("!"'& #!&4!. #-"+'%" !("!'"#%'-"%&!',%'' !!-/!!!'#&'%!.#%!4 +%&,!"%'&#+%#"&4 '"+%!!+%'%'- '#%"%'/'"&+##"%'"'"5&&'"%%"!'&!" % "%%"%&-'' #&&"!" +!'/%("!%" ' %&&'"#&+##"%'" '"+&!&&,''/!#&'%!'%4 " &&"!&#%"+'"&+##"%''#" !((,!'"#/"%(&'&4 "3 8&/'"##!-'!'!.''%/%&4-"%-''" &&"!! &''"+!%&2'%'2&&&'%(&'&2!!'%'-''#+"%"3%'7!86794 %!'&.#%!'""3 84 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV & "!! ! ""!&" &"),(!"& #! ") "& & " "+("("('!("(", & "!" ! "&,!) ( " ("" " "" " "&" )!(!&! -)-!( , !" !( !) ("& '!&!. !' )( , ",.! ( (""& &!&& "!"#,'!% & & #(") ""!," "#!"(") ""!!!"! ")"!" , Honestly, the eight murals recently installed in support of Uplift Local have given so many people joy. How can someone walk by Damon Belanger's "California Avenue Marching Band" without smiling? Our goal to get people off computer screens and outside to discover art has made a positive impact. In addition, the micro grant program has connected many people with non- traditional art. I would encourage the commission to continue these positive projects which support the businesses and people of the City. As mentioned earlier in this application, I am part of an ad hoc committee with members from both the Public Art Commission and the Human Relations Commission. We are working together to learn more about the people who live, work and visit Palo Alto in order to hire artists to create an artwork for King Plaza. This goal will be completed over the next year. Successfully hosting Code: ART2. This festival will bring art exhibits to outdoor spaces downtown. The first Code: ART was a success hosting a variety of urban interventions that invited interaction. I look forward to fundraising, selecting artists and working with guests during Code: ART2. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R Loren K Gordon 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Mette Huberman Mette Huberman 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU *For more than 20 years, I have sung as a Second Soprano in the Stanford Symphonic Chorus, performing concerts at Stanford Memorial Church and at Bing Concert Hall every quarter and learning more than 80 different choral pieces. *I am a Stanford Alumni member and have taken six Stanford continuing education courses in art history. *At City College in San Francisco, I have taken courses in weaving and tapestry. I have also taken courses in weaving with local weavers in Palo Alto and Redwood City. *I have attended numerous art history lectures at Stanford Art Department and at local museums. *I am a member of the Legion of Honor and de Young museums. *For the past two years, I have served as Secretary in my Home Owners Association (HOA). Mette Huberman * I have two Master degrees: one in Education Research from Stanford University and one in Education Psychology from Aarhus University in Denmark. I am also two-thirds done with a third Master degree in Art History at the Academy of Art University in San Francisco. In addition, I have taken six college-level classes in art history at UC Berkeley Extension and at Cañada College. *I worked for almost 25 years at a non-profit research company, the American Institutes for Research (AIR). As a Senior Research Analyst, I directed projects evaluating educational programs, including local school arts education programs. American Institutes for Research (AIR), Palo Alto ✔ Senior Research Analyst ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV I find the Public Art Plan for the California Avenue district very interesting because it seeks to strengthen and bring together a whole business district around public art, including businesses, residents, local artists, and visitors. I also appreciate that the project is being carried out in partnership with Barbara Goldstein & Associates, a woman-led, public art planning and consulting firm. One of their projects, Womanhood, seeks ways to honor women s historic contributions to our region and beyond. The issue of female recognition and appreciation is an issue dear to my heart. In my art history scholarship, I am focusing on female artist recognition and appreciation historically. Mette Huberman I care deeply about public art. I believe that public art improves a local community and reflects the people and values of the community. Public art can also bring together a diverse community around common goals of beautification, sustainability, and diversity, in particular after a pandemic. I am an Art History Scholar and have taken numerous courses in art history and art production. I have worked for more than 20 years as a Senior Research Analyst at a non-profit company directing projects to evaluate educational programs, including school arts education programs. I have expertise in all aspects of an evaluation project, from managing people and budgets, to interviewing and surveying stakeholders, analyzing data, and summarizing and presenting data. These skills, as well as my deep knowledge of art history and art, will be very useful as a member of the Public Art Commission. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Apart from skimming the City of Palo Alto Public Art Master Plan, I do not have experience with the document but I appreciate its comprehensiveness, in particular the focus on Goals and Recommendations such as environmental projects and educational initiatives. If selected to the Public Art Commission, I look forward to studying this document in detail. Mette Huberman As mentioned above, I care deeply about female artist recognition and appreciation, which would be a goal I would like to pursue as part of the commission s work. My art historical knowledge on the topic, as well as my experience working with stakeholders and artists as part of my evaluation work, will be very helpful in this process. I also care about digitizing art experiences by providing online interactive tours and information to reach as broad an audience as possible. Some of these already exist, such as the Temporary Murals project and the Airlift Microgrant Program, but I would like to work on digitizing all of Palo Alto s public art in similar ways to feature both the art and the contributing artists. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/21 Mette Huberman Mette B. Huberman 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Ian Klaus Ian Klaus 1002 Chileno Valley Rd Petaluma 9179222000 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU My current term of service as a member of the Public Arts Commission began in May 2018. During the course of the term, I have regularly joined the Commission meetings, served on a number of selection panels outside of the regular meetings, and worked with Commission staff to brainstorm on new ways public art could be used to bring together policy goals and cultural development, such as around climate change and the Sustainable Development Goals. Ian Klaus Current Serving Member Since 2017, I have served as an adviser to a number of cities and city networks on policy issues from the climate crisis to economic opportunity. My scholarly research over the same time has focused on enabling cities to address global challenges. This work has included policy development, but also efforts to use art and culture to explore and explain policy options. Prior to 2017, I served as senior adviser for global cities at the U.S. Department of State, and advised the director of Policy Planning and the secretary of State on issues related to both urbanization and cultural affairs. Chicago Council on Global Affairs Senior Fellow for Global Cities ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV In a March 17 joint meeting with the Human Relations Committee, PAC Chair Miyaji briefly mentioned discussions the PAC had concerning signage for public art, and possible options to ensure said signage is used to advance the Council's goals, and the equity agenda in particular. This should include signage for Public Art in Private Development. Art from the program is meant to be accessible and open to the public, but its location within private developments often hides this fact. Signage that made clear the right of the public to engage such art would advance equity while also developing an approach that other local cities with such a program could use. New responsibilities involve learning, and my contributions to the Public Art Commission, and in turn to the city's art more widely, have deepened and improved as I have grown more familiar with the program and the city. As such, I am seeking a second term on the Public Art Commission to take further advantage of the knowledge and experience I have gained. In particular, I have seen a strengthening of the relationship between Council goals and priorities and public art development. The Public Art Commission has directly engaged in support of the Council equity agenda and the Uplift Local effort. In early 2020, Commission goals and language for the year was brought broadly in line with city priorities. This synthesis - which with a background in policy and art I am well-situated to further - can help make the case for public art and help the Council deliver results for residents and visitors. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV During the application and interview process in 2018, I noted that I consider the Plan to be a framework within which we operate rather than something to be constantly renegotiated through new efforts. Since then, I have participated in numerous Commission meetings focused on the development of a similar such plan for California Avenue. Similarly, I feel that plan, and the orginal, help us focus on the development of public art projects that deliver on the goals laid out therein rather than having to constantly reinvent a new concept for art in Palo Alto. Oakland Mayor Libby Schaaf noted that 2020 featured dual pandemics, that of Covid-19 and that of systemic racism. The Public Arts Commission, following Council lead, was active on both fronts with the Black Lives Matter mural on Hamilton Avenue and the temporary mural project in support of Uplift Local. ITthe Commission should attempt to stay closely linked to the Council in such a way. The work has only begun on recovery and change around the dual pandemics, but the Commission should also pursue opportunities to engage with public art on additional Council priorities, including any significant discussions or changes around mobility, parking and climate change more broadly. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R April 6 2021 Ian Klaus Ian Klaus 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Emily Meyer Emily Meyer 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU My husband and I lived in Palo Alto between 1999-2004, years in which he attended graduate school and I founded my company at our apartment on Addison Avenue. Upon the birth of our second child, we returned to Palo Alto for its diverse community and strong public schools in 2010. While raising our children in the PAUSD system, our family has frequently participated in community organizations such as Palo Alto Little League, Palo Alto Art Center, and Pacific Art League, and regularly attended the community events May Fete and Festival of the Arts. As a parent volunteer, I have contributed time to All Students Matter, YMCA Project Cornerstone, Addison Elementary Site Council, and the Addison Equity Team. We have recently become members and contributed to the Palo Alto Community Fund. Emily Meyer Social Media, Instagram Co-Founder, & Chief Creative Officer, Tea Collection, $40M children’s wear lifestyle brand. Total of 25 years in the apparel industry. BFA, Fashion Design, Parson School of Design, New York, New York. CORO NorCal, Women in Leadership certificate Retired Executive 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV (See Portfolio) I appreciate art that inspires conversation and connection for all, evoking a sense of belonging and inclusion. Environmental art has the unique opportunity to engage people in the issues of preservation and social justice. Tangible play and interaction are powerful ways to engage all ages and abilities. Scale and location are tools for communicating captivating messages, accessing the public where they live, work and play. These pieces: Bucolic Labyrinth, Foraging Islands, Blue Trees, Bliss in the Moment, and the BLM mural, successfully calls attention to the values and engages the people of Palo Alto’s community. Emily Meyer Serving on the commission would combine my interests in serving our community with the best of my strengths and skills. As co-founder of a mission-driven lifestyle brand, I am and always have been, committed to inspiring global connection and curiosity through design. I would bring expansive entrepreneurial and professional experience to the position of commissioner. My journey includes starting and leading all creative facets of product design and marketing for my children’s apparel company, Tea Collection. With my business partner, I co-led a breadth of strategic and operational aspects from board communications and human resources management, to profitable financial discipline. As a member of the Addison Elementary School Site Council, I am currently leading the creation and installation of an extensive interior mural project for the newly constructed building on campus. This multi-year project has required ample concept development. Once engaging the appropriate design partner, we have been able to provide schematics for stakeholder feedback and lead discussions on feasibility and flexibility to meet execution and funding goals. I am also a member of the newly formed Equity Team at Addison Elementary, a group of staff and parents working to build empathy and trust for our community. I believe art and design are powerful tools for messaging values while illustrating norms of belonging. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV I have no specific experience with the Palo Art Public Art Master Plan. I have read it and understand the document as a guide for objectives and strategies. Emily Meyer (See Portfolio) If selected for a commissionership, I would like to help increase awareness of the Public Art Commission and its goal of creating an inspiring expression of Palo Alto. I see opportunities to work with local academic institutions identifying themes of Native American culture to reflect the foundation of our geography. I easily envision bold and energetic graphic art directing the public to the beauty and accessibility of public spaces in our community. Based on my work with Addison Elementary, I would propose a partnership with PAUSD to generate student-led artistry about themes important to their student body. With my skills, experience, and personality, I believe myself to be a strong candidate for the Palo Alto Public Art Commission. I would be a committed member and dedicated spokesperson using my authentic voice to amplify the creative and meaningful work, helping our community engage with art. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Emily Meyer Emily Meyer ++'$/$*)*-/!*'$*ϵ($'4 4 - '*'/*-/*(($..$*) +-$'ϬϪϬϫ $*"-+#4 Ѐ(+..$*)/ *0//# *)1 -./$*)!*-"'*'2- ) ..Љ+-/$0'-'4#*2+ *+' *!$1 -. 0'/0- .- '$5 2 - (*- '$& /#) $Ȃ - )/ϴ. *)/#$.+ -.*)'+#$'*.*+#4ϵ - / *'' /$*)ϵ#$'- )Ͻ.++- '*(+)4ϵ/* ($..$*)Љ-$1 )-) $).+$-$)""'*'*)) /$*))0-$*.$/4/#-*0"# .$")ϴ "- 20+$) 3.ϵ// ) -.*).#**'*! .$")$)ϵ)/# )(*1 /*)-)$.*ϵ'$!*-)$$)ϫϳϳϱϴ4#0.)) '$1 $)'*'/*$)ϫϳϳϳЉϬϪϪϯϴȅ -ϯ$/$*)'4 -.$))-)$.*ϵ2 - /0-) /*'*'/*$)ϬϪϫϪ/*-$. *0-!($'4ϴ - -$.$)"*0-/2*#$'- )$).#**'.ϵ2# - #1 ))/$1 1*'0)/ -ϵȅ -- /$-$)"!-*((4*(+)4$)ϬϪϫϲϴ 0$'/ *'' /$*)!-*(1$.$*)*!'$! ./4' -)2$/#( )$)"!0'1'0 .ϴ1 -4+-*0/2.- / 2$/#/# +0-+*. *!$).+$-$)"" 2- ) ..*!"'*'0'/0- .ϴ0-.*+#$./$/ ++- '*'' /$*)ϵ- # $)/ -)/$*)'0./*( -.*0/$,0 .) +-/( )/./*- .ϴ 0- !$)$)"-)/'*".0++*-/ *(( - ϴ.#$ !- /$1 Ȃ$ -ϵ ' 1 '*+( )/*!''+-*0/.)(-& /$)"*''/ -' Ж+-$)/ )$"$/'Зϴ *Љ' ''./-/ "$$)$/$/$1 .ϵ($)/$)$)"!$))$'+-*!$/$'$/4ϴ (( ). +'))$)")**-$)/$*)2.. - ,0$- /2 )- /$1 )./-/ "$ +-/( )/.ϵ(*/$1/$)"/ (./*2-'$")( )/$)#$ 1$)"0.$) ..*% /$1 .ϴ - . )/'4ϵ.( ( -*!/# $.*)' ( )/-4$/ *0)$'$)'*'/*ϵ (' $)"#$"#'4**-$)/ (0-'$)./''/$*)+-*% / /#-*0"#*0//# ) 2'4*)./-0/ ($)0$'$)"ϴ - . )/ # - $..(+' *!(4+-*! ..$*)' 3+ -$ ) ϵ++- $/$*)*!'*'/*0'$-/ϵ)$ .!*-0'/0- +0'$-/+-*% /.ϴ *'' /$*)ϵ*-/#( -$)/$1 -/$./ .$")-/) -.#$+.ϵ''ϬϪϫϲ 6KDZQHH6HPLQROH )%($) -%*-ϴ$VVLQLERLQH6LRX[0RWKHUGDXJKWHUJUDQGPRWKHUFROOHFWLYH-*URZLQJ7KXQGHUU KWWSVEORJWHDFROOHFWLRQFRPEHKLQGWKHGHVLJQQDWLYHDUWLVWV[WHDFROOHFWLRQ 0-- )/'4 $)" )/ -$*-0-'-*% /!*-$.*)' ( )/-4 *''*-/$1 Ȃ*-/ϵ. -1$)"/# ./0 )/.ϵ./Ȃ)*((0)$/4*!$.*)' ( )/-4ϴ ).+$- 4/- .))/0- ϵ(* -))./$(0'/$)""-+#$2*-& 1*& . 0-$*.$/4)2 ϴ ..0 .*! )/ - ./ ++- $/ -//#/$).+$- .*)1 -./$*))*)) /$*)!*-''ϵ 1*&$)". ). *! '*)"$)")$)'0.$*)ϴ )1$-*)( )/'-/#./# 0)$,0 *++*-/0)$/4/* )"" + *+' $)/# $..0 .*!+- . -1/$*)).*$'%0./$ ϴ )"$' $)/ -/$*)- +*2 -!0'24./* )"" $/$5 ).*!''" .)$'$/$ .2$/#+0'$-/ϴ# 0. *!.' )'*/$*)- 0)$,0 /**'.!*-*((0)$/$)"( )$)"!0'( .." .ϵ ..$)"/# +0'$2# - /# 4'$1 ϵ2*-&)+'4ϴ *-$.*)' ( )/-4#**'*((0)$/4 ( -.)'4Н- . )/ 4($'4 4 -ϩ $/#Ͻ-$ ) 0*'$ 4-$)/#45 ''5м$)"Ѐ.'5 (QJDJHVIDPLOLHVDQGFKLOGUHQ&UHDWHVDPRPHQWRIPHGLWDWLRQRQHQYLURQPHQWDOSUHVHUYDWLRQ *-"$)" .').4/ -.# 0'+/0- м43 -& *)0( )/'.' ϴ$. .2- ) ..*! )1$-*)( )/'+- . -1/$*)0. .ϴ)$,0 *((0)$/4+-/$$+/$*) '0 - .4*)./)/$)$(*+*0'*.м$)".'5 /-$&$)"$.+'4*!*'*-ϵ#*)*-$)"/# .4(*')1'0 .*!'*'/*ϴ '$..$)/# *( )/ϵ4( .**- м43 -& 3/-*-$)-4( /#**!24Љ!$)$)"ϴ$/#$/.*)/-./$)"$)0./-$'(/ -$'.ϵ/#$.+$ ''.// )/$*)/*4'$)"/-$'.!*-+ *+' /* )"" 2$/#/# +- . -1 )/0-' .+ .ϴ '& $1 .// -0-'м ($'/*)/- / 0/$!0'$.+'4*!$1 -.$/4ϴ (+- ..$1 /$1/$*)/*+-/$$+/ $))/$*)Љ2$ -''4!*- ,0$/4ϴ .ϩ*'.!*-/# 0'$-/*(($..$*) !. ' / !*-*(($..$*) -.#$+ϵ 2*0''$& /*# '+$)- . 2- ) ..*!/# 0'$-/*(($..$*))$/."*'*!- /$)") $).+$-$)" 3+- ..$*)*!'*'/*ϴ . *++*-/0)$/$ ./*2*-&2$/#'*' ($$)./$/0/$*).$ )/$!4$)"/# ( .*!/$1 ( -$)0'/0- /*- !' //# !*0)/$*)*! *0-" *"-+#4ϴ .$'4 )1$.$*)*') ) -" /$"-+#$-/$- /$)"/# +0'$/*/# 0/4) ..$$'$/4*!+0'$.+ .$) *0-*((0)$/4ϴ. *)(42*-&2$/#$.*)' ( )/-4ϵ 2*0'+-*+*. +-/) -.#$+2$/#/*" ) -/ ./0 )/Љ' -/$./-4 *0//# ( .$(+*-/)//*/# $-./0 )/*4ϴ 2*0''$& /*. /# 0$'$)")./- )"/# )$)"*!- '/$*).#$+.(*)"$1 -. "-*0+.ϵ- /$)"*)) /$*). /2 )/# +0'$2$/# -/$./.)/# $-( )$)"!0'2*-&ϴ Н Љ Н м(+0. . *-$.*)' ( )/-4#**'*((0)$/4 ( -.)'4Н- . )/ 4($'4 4 -ϩ $/#Ͻ-$ ) $/#+-/) -.ϵ0$'2- ) ..*!/$1 ( -$)0'/0- .ϴ -/) -2$/#/)!*-)$1 -.$/4ϵ . )/ -!*-0'$ -1$ /* ' -/ )/$1 0'/0- ../# !*0)/$*)*!*0-" *"-+#4ϴ #'*) $''" 0-'4))#$ -())м)/-050. 0(*!/0-' $./*-4 . '-" .' "-+#$-/!*-''$)"// )/$*)/*+0'$.+ . 4)($24!$)$)""-+#$.$.)*++*-/0)$/4!*-$)- . *((0)$/4 )"" ( )/ϴ 3/ -$*- -($0-'м$.*)' ( )/-4 *''*2$)"# -$/" (+0.-/2*-&ϵ- / *((0)$/4Љ0$'$)"*++*-/0)$/4!*-+0'$ 3+- ..$*)*! ,0'$/4)$)'0.$1$/4ϴ 3/ -$*-$)/ 0-'.м(+0. . *' 3+- ..$*)*!4*0/#ϵ*'*-)- /$1$/4ϴ)"" .4*0/#)*((0)$/4*!+0'$.#**' $./-$/ϴ *$' )"" ( )/ )/ -. +0-+*. /# *$' -/.'/!*-(!*- )""$)"!($'$ .ϩ#$'- )/+0'$.+ .ϵ- /$)"2- ) ..*!/# '*'/*0'$-/.*(($..$*)ϴ #)&4*0!*-/# *++*-/0)$/4/*++'4ϴ $/#(4.&$''.ϵ 3+ -$ ) ϵ)+ -.*)'$/4ϵ '$ 1 (4. '!/* ./-*)")$/ !*-/# '*'/*0'$-/*(($..$*)ϴ 2*0' *(($// ( ( -) $/ .+*& .+ -.*)0.$)"(40/# )/$1*$ /*(+'$!4/# - /$1 )( )$)"!0'2*-&ϵ# '+$)"*0- *((0)$/4 )"" 2$/#-/ϴ Please email all oompleted applications to Jessica.Bra ~CityofPaloAlto.org or Clty.Clerk@CltyofPaloAlto.org Public Art Commission Personal Information -Note : The PAC regularly meets the third Thursdays of the month at 7:00 P.M. Name : Ben M iyaji Address: ~I Phone ~ome office Phone: E·mail : Are you a Palo Alto Resident?Oves®No Do you have any relatives or members of your household who are employed by the City of Palo Alto , who are currently serving on the City Council , or who are Commissioners or Board Members?QYes (!)No Are you available and committed to complete the term applied for?®ves ~o California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (fair Political Practices Commi$S.iQo , Conflict of Interest , Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to ; 1) engage in business with the City, 2) provide products or services for City projects , or 3) be affected by decisions of the board or comm ission you are applying for? ()vea{!)No Excluding your principal residence, do you or your spouse own real property in Palo Alto?Oves®No Consent to Publish Peraonal Information on the City of Palo Alto Webtlte California Government Code Section 6254.21 states , in part, "No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual. a This consent form will not be redacted and will be attached to the Application and posted to the City's website . For the full code, review the California Government Code Sect ion 6254.21 Read the code , and check only ONE option below: Q I give permission for the City of Palo Alto to post to the City's website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address , phone numbers, and email address from the attached Board and Commission Application prior to posting to the City's website. I am providing n following atte1 nate n vr on a .d request that I'! '/ 1 e the following contact Information Instead. Address : Cell Phone : Oome Oottice Phone: E-mail : Page 1 Public Art Commission How did you learn about the vacancy on the Public Art Commission? ........ Commun ity Group D Daily Post Ema il from the City ........ Palo Alto Weekly Other: Member of the p11hljc Art Cgmmj55jgn City Website 1--1 Flyer List relevant education, training, experience, certificates of training , llcenaes, or profeaalonal registration: (621 characters) I have served on the Palo Alto Public Art Commiss i on (PAC ) since 2013 . I have been the chair for the past two years. I currently am a member of the Arts & Culture Commission of Contra Costa County. I served on the San Jose Arts Commissi on from 1992-2014 and held various leadership positions including Chair for three consecutive years. I have also served many non-profit boards. Employment D Current Employer Employer: Siemens Occupation : Senior Engineer I./ I Last Employer Describe your involvement in community activities , volunteer and civic organizations : (1311 characters) Through my service on various comm issions over the years, I have been i nvolved in many community acti vities, includi ng: •121Chair of the San Jose Mineta Internationa l Airport Public Art Master Plan steering comm i ttee. The 30-person committee consisted of two city council members and various leaders of the community. •12!Speaking at various openings of community centers, libraries and public art pieces. •IMttending numerous events to engage w ith attendees about their experiences and reasons for attending funct i ons. •OOrganized community events for the entertainment of the population. I am also a wedding officiant and performed over 6,000 wedding ceremoni es. Many of these ceremonies have been performed as a volunteer offi ciant for the County of Santa Clara. Page2 Public Art Commission 1. Why are you Interested in serving on the Public Art Commission and what experience would you bring to the position? (151 B characters) Public art tells the story of a community and shows it soul. Bringing public art to the community, not just the downtown areas but into the neighborhoods would enliven these areas. My almost 3C year experiences serving on various commissions would be an asset in the public art program . 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) The idea of a Racial Equity art piece was brought to the Public Art Commission by the city council. The commission is finalizing plans for this project and will forward to the city council shortly. Thi s is of vital importance to the community as we move forward and include all peoples in city activities. Page 3 Public Art Commission 3. If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) In conjunction with the Human Rights Commission (HRC), the Public Art Commission (PAC) has started a collaboration about the importance of Racial Equity in our community. The unique perspectives of the HRC and PAC, while diverse in nature are a natural fit to bring the meaning of Rac ial Equity to Palo Alto. 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan I served as chair of the Palo Alto Public Art Master Plan Steering Committee. I am well versed in the plan and the master plan helps the commission formulate its work plan for the coming year. Page4 Public Art Commission 5. Please conflnn that you have read the Boards and Comml88lona Handbook: .{!Lvea Q No Page 5 Public Art Commission 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Cleia Dantas Muggler Cleia Dantas Muggler 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Since moving to Palo Alto over 10 years ago, most of my involvement in the community has been through volunteer work at different PAUSD schools. I started as a volunteer at Juana Briones Elementary School, which my children attended. I held several roles, from teacher's assistant, library helper, to noon activities coordinator. While being a volunteer at Briones, one of the most significant projects I contributed to was a community artwork in honor of local Japanese families that had relatives affected by the 2011 Tsunami. A few years later as my kids moved to Hoover Elementary School, I became an executive board member of the Parents and Teachers Association (PTA) and served as the financial secretary. It was a great opportunity to learn more about the school's community and contribute to the school's programs and activities. The following year, I became the PTA's treasurer at Terman Middle School (now Ellen Fletcher Middle School), a role that lasted two years and allowed me to make significant and long-lasting contributions. During my last year at Fletcher, I was the co-Chair for the 8th-grade Promotion Committee. My role included the planning and execution of the graduation party along with other parents. Cleia Dantas Muggler I have a bachelor's degree in Finance from P. Carey School of Business at Arizona State University, an Associate Degree in Arts from Foothills College specializing in Graphic and Interactive Design, and a master's in fine arts from San Jose State University with an emphasis in Digital Media Arts. Here is an example of one of my latest work http://cleiamuggler.com/recollection.html For more details about my background, please visit https://www.linkedin.com/in/cleiadantasmuggler San Jose State University ✔ Teaching Associate ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV The safety and well being of our citizens are the most important issues in Palo Alto. Since moving to Palo Alto, my neighborhood has experienced the worst tragedy a parent can experience at the Caltrain train intersections at Meadow and Charleston roads. Those tragedies raised several important issues; however, the city has yet to come with a solution for our residents that goes beyond a crossing gate. I believe that by using art as a medium, we can offer a helping hand to members of our community who suffer from depression and anxiety. Perhaps, creating better connections between art programs funded by the City of Palo Alto and local schools can help prevent some future tragedies. Another hot topic is the expansion of rail service to include the California High-Speed Rail. This major development will significantly transform our community and therefore it is being resisted by many members of our community. This development is an important undertaking for our economy and the environment. However, it can be an overwhelming disruption to the lives of many members of our community. Perhaps, through the arts, we can bridge the gap between the proponents of the High-Speed Rail and the opposition. Arts might help to drive a common understanding of the benefits and foresee the actual impact of this development, leading to a more educated conversation and better outcomes for everyone. Cleia Dantas Muggler Besides raising a family and volunteering in several positions at PAUSD for the past few years, I also managed to go back to graduate school and pursue a masters degree in digital media arts at San Jose State University where I graduated in June of 2020. During my graduate studies, I was involved in the university's art community where I contributed, with fellow artists, to art shows and I thought introductory art courses to university students. Furthermore, I attended several artists' lectures, participated in international art conferences, organized gallery openings, and created my own exhibitions. The two and a half years I spent at SJSU greatly expanded my knowledge of the arts and its impact on society. I greatly appreciate the connections and friends I made at SJSU and across the world. I believe that having a position in the Public Art Commission will be a great opportunity to be involved in a subject that I am very passionate about. Most importantly it will allow me to contribute to Palo Alto's art community by utilizing the knowledge and experience I acquired over the years as a researcher. Furthermore, my professional background in accounting and finance will help overcome the challenges many art projects face, proper funding. The city of Palo Alto has done an incredible job in providing its residents access to innovative artworks, I can effectively contribute to the continuing facilitation of access and support the implementation of the city's Public Art Master Plan. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Cleia Dantas Muggler From my perspective, it seems that the many wonderful initiatives from the Palo Alto Art Commission are not reaching a wide enough audience. Thus, my work would also involve outreach work to increase engagement and awareness throughout the community. A second goal would be to help younger generations get engaged through art events. This work could be executed with the help of local artists as well as students and faculty from SJSU and Stanford for instance. Connecting the different art communities in the Bay Area and inviting them to participate in events in Palo Alto would help expand the opportunities and make a difference in our community. This work will help aspiring young artists develop their talents as well as express their sentiments and be better understood. Palo Alto has the space and talent to execute those exciting initiatives. All it needs is greater engagement within our community and outreach to neighboring areas. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Cleia Dantas Muggler Cleia Dantas Muggler 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Harriet Stern Harriet Stern 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU In my community I have taken a number of classes at Pacific Art League, Mid-Peninsula Media Center, The Art Center. I attend lectures and music at Stanford, visit arts programming often at all sorts of venues from open studios to the Anderson collection and everything in between. We attend lots of community and regional theater. My kids are in PAUSD since 2018. Palo Alto Weekly subscriber. My volunteering is majority around school. I try to do one long-term commitment a year coupled with as many one-off assignments possible. To give an example these are my recent longer term volunteer commitments: Odyssey of the Mind Coach, Elementary Division—2017 World Championship Qualifiers, All Students Matter Literacy Volunteer, Ravenswood School District 2018/19, Palo Alto High School, College Career Center/Career Speaker Series Volunteer 2019/20, 2020/21, The Reach Foundation Mentor, Santa Clara High School 2020/21. Political Volunteer 2020. Harriet Stern BA, Art History, Kenyon College, Gambier, OH Graduate Studies, Modern Art History ,Theory and Criticism, School of the Art Institute of Chicago Diploma, Interior Architecture, Inchbald School of Design, London Internships: Hirshhorn Museum , Washington D.C.; Peggy Guggenheim Collection, Venice, IT; Chicago Park District, Archives Dept.; Art Institute of Chicago, Dept. of 20th Century Art TA, School of the Art Institute of Chicago Asst. Director, White Pine Gallery, Chicago Corporate Art Consultant, Merrill Chase Galleries and Corporate Artworks, Schaumberg, IL Curator, IBEW Local 1245, Vacaville, CA Corporate Art Works, Arlington Heights, IL ✔ Corporate Art Consultant ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it.$rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV At the February 2021 meeting the PAC was asked by the City Council to consider Racial Equity as the theme for artwork for King Plaza at City Hall. During the discussion Mayor DuBois suggested that some Palo Altans may be unaware that King Plaza is named for Dr. AND Mrs. King. I presumed it was named after MLK. It warmed my heart to know that our city valued Mrs. King as an equal to her husband in the dedication of this plaza in 2008. It followed in the meeting that perhaps this should be the focus of the PAC: a better way to inform Palo Altans that King Plaza is named for Dr. AND Mrs. King. This is the issue which is of particular interest to me. During the discussion it was disclosed that: fewer people visit City Hall due to paperless commerce and communication; there are severe weight limitations for art or objects due to the parking garage under King Plaza; the Plaza is higher in the middle than on one side; there may be rules about moving the dedication plaque. Given the above, I suggest a sound installation wherein a touch pad is embedded under the tile so that as the foot strikes, Dr. King’s voice is triggered and rings out from a hidden speaker. One can take in a few lines of his poignant oration. In another part of the plaza, the same sequence of events produces the voice of Mrs. King, delivering her own brand of discourse. Repeat in different areas, with varying types of communications from the Kings and it will be clear the plaza is named for Dr. and Mrs. King. Harriet Stern With our abundant and diverse public art, Palo Alto communicates that creativity and open expression are celebrated here. Our artworks illustrate our community’s values and vision. The Public Art Commission serves a critical role in the direction of this vision—aesthetic and sociological. My interests in serving on the Public Art Commission are manifold. My primary objectives are to: 1.ensure that permanent acquisitions and temporary installations reflect Palo Alto’s values. 2.attempt to reach segments of the community not currently engaged by the public art program and build greater awareness about the program and the collection. 3.guarantee that the community trusts that decisions made around public art are completely transparent and accountable. 4.support local artists and promote art within the community. 5.continue the long-term plans established in the Public Art Master Plan and New Cal Ave Plan and strategize future long-term needs for the collection and programming. As a lifelong collector and professional in the arts I have practical experience working with artists, end-users, framers, auction houses, printers and installers on project development, proposals, acquisitions, commissions, and installations. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV Yes, I am familiar with the Master Plan. I attended a focus group with the authors and have read the final document. I know that we are about halfway through the ten year plan. The Master Plan has effectively established a professional approach to our Public Art Program and its administration. The goals and timeline are very clearly stated. The Cubberley Artist Studios are included in the Master Plan as a point of discussion. It is my very strong opinion that if Cubberley is used for something else in the future, Palo Alto should maintain subsidised artist studios somewhere within our city limits. Artists enhance diversity of our community. They can't afford to be here without our support. Harriet Stern Proactively fight Hate with Art. For example: 1.Use city transportation as circulating artworks by pairing a visual artist with organizations which experience intolerance, xenophobia or racism to develop conceptual artwork which then become vehicle wraps. Thus, you make a powerful statement about inclusion, an important Palo Alto value, which literally travels the streets. Doing a quick search, I found local groups we might consider teaming with to create the "Coexist Coach" or "Tolerance Transporter": NAACP of SV, Nuestra Casa, American Muslim Voice Foundation, The LGBTQ Youth Space and WizChinese. 2.Make Race and Equity the focus of the Temporary Art Program at King Plaza. 3.Create an Artist in Residency program wherein an artist (nonwhite male) is embedded in the Palo Alto Police Department. The artist produces a piece to be displayed in the vicinity of the new Public Safety Building. Build Bridges with Art. Here are some ideas: 1.Encourage cooperative projects between East Palo Alto and Palo Alto. 2.Work with our International Sister Cities on arts exchanges. 3.Be more collaborative with Cubberley Artists and review and revise the program. 4.Mayor DuBois’ initiative for Sister Cities within the US would produce a rich exchange for artists as well. Likely we can find artists to meet via Zoom to discuss the State of Art Making and exchange ideas. It would great to get a room full of our artists together with a room full of artists from the coast of Massachusetts or central Indiana or Arkansas for example to find out what inspires and challenges them. I am excited to participate in any of the above processes. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 03/31/2021 Harriet Stern HARRIET STERN Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursdays of the month at 7:00 P.M......... Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Public Art Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website clear and communicative materials to be disseminated online and via social Lisa Waltuch Lisa Waltuch Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Public Art Commission How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer ✔ Self-Employed artist and designer ✔ While living with my family in Costa Rica for three years, I started a bilingual storytelling event series modeled on the approach of "The Moth." I recruited and coached storytellers, found musicians and MC, coordinated volunteers to help with marketing, venue logistics and food/drink. We hosted international storytellers in our community from Brazil, Australia, England, Costa Rica, Canada, US, Argentina and more. This past summer and fall I worked with a small group of people through Future Now Fund to create a giving circle. Our goal was to invite as many people as we could to make individual contributions that could add up to enough money to flip our chosen state legislatures from red to blue. We gathered a community of 500 people between the ages of 14-86, from 31 states and raised $156K in 77 days. For 10 years, I served as a board member for WomensLaw.org, a web-based non-profit organization for victims of domestic violence and their advocates. My responsibilities included: board decision-making, fundraising and design consultation. Lisa Waltuch Lisa Waltuch Studios PROFESSIONAL EXPERIENCE: Practicing Artist - Uses art to tell people's stories. See lisawaltuchstudios.com and lisawaltuchsilkstudios.com. Storytelling Producer - See scherezadestorytelling.com. 20 year career as a Creative Director (The Met, Walmart, others) EDUCATION: Rhode Island School of Design, MFA, Graphic Design, Stanford, BA, Design and Art History, Node Center for curatorial studies: coursework in curation TEACHING: Adjunct Faculty at NYU's Interactive Telecommunications Program EXHIBITIONS: Art Basel Miami, The Fearless Artist Gallery Page 3 Public Art Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. (Archived videos available from the Midpen Media Center. (1518 characters) 1. Why are you interested in serving on the Public Art Commission and what experience would you bring to the position? (1518 characters) I am interested in serving on the Public Art Commission so I can make a lasting contribution to my community due to my work as an artist, my experience as a designer and my belief that exposure to art leads to both an understanding of differences and a better quality of life for all. I grew up in Palo Alto and attended Terman Jr. High, Gunn High School, Stanford University and worked as a graphic designer for several design firms in downtown Palo Alto. My mother worked for the city of Palo Alto teaching dance exercise until she was in her 70s at Lucie Stern. After my local experiences, I lived on the East Coast and then in Costa Rica, building a successful professional career, delving deep into the worlds of design, art, and culture, and starting a family. Two years ago, I returned home: my three children happily attend Juana Briones, Fletcher and Gunn and have all participated in Palo Alto Children's Theater productions. I have friends, family and professional relationships here. I am excited not only to dive into the flourishing creative community here, but to bring my experiences and perspectives from my life outside of Palo Alto back to my hometown. In particular, I am excited to lead efforts to use art to knit together the beautiful diversity of Palo Alto. I am interested in some of the themes that emerged from the Commission meeting on March 18, 2021 including addressing cultural, racial and ethnic diversity and social justice in public art. In the time that I left and then returned to Palo Alto, it has become an incredibly diverse and vibrant international community. Yet many groups feel that their voices aren't heard, or that their issues are not represented. As I learned from living in diverse communities in Brooklyn, NY and Costa Rica, art, a universal language with the ability to cut across all cultures, can bring these groups together and allow everybody to be seen and heard. We can help answer the question: Who are we as a community composed of many different cultures? What kind of metaphorical quilt can be made with these wonderfully different fabrics? As an example, the Commission could sponsor an artist to create an interactive public art piece that includes a diverse group of local citizens from as many backgrounds as possible, contributing in their own unique way. Page 4 Public Art Commission 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection, but will help you better understand the work of the commission. (759 characters) Public Art Master Plan 3. If you are appointed, what specific goals would you like to see the Public Art Commission achieve, and how would you help in the process? (1656 characters) 1. Demystification of public art commissions. I will use my design skills to develop clear and communicative materials to be disseminated online and via social media. 2. Residency program. A "residency" could be developed in which an artist teaches adults and children in the community and then works with those students to create a temporary piece of public art. My Brooklyn community has an excellent example of how this can work. I would work with my colleagues to secure funding. 3. Relationship between tech and art. Since our area is known for technology, opportunities for forging a connection between public art and tech are ripe in Palo Alto. Examples of art and technology merging continue to grow in digital, interactive, the maker movement, and even $69M NFTs! I would like to work on projects that build relationships between the two industries. 4. Collaboration between functional city projects and commissioned artists i.e. bike racks, public restrooms. When I was a graduate student at RISD, my Dutch professors had designed the money, postage stamps, phone booths, mailboxes for Holland. Palo Alto, too, can use design to improve public life. 5. Public art as an interactive and collaborative experience. By definition, interactive art engages people to create a sense of delight and shared sense of pride. The subject of my MFA thesis was collaboration and most of my art is collaborative. One of my favorite museums is MOMATH in NYC where everything is interactive and everyone is having fun! Let's bring collaborative art to Palo Alto and engage the community. I have closely read this the Public Art Master Plan and understand the value of a having a comprehensive plan to guide the work of the Public Art Program in Palo Alto. It was well researched, with sound recommendations and suggestions in planning, outreach, exposure and inclusion of artists on city boards and panels. Implementation of this plan will contribute to the future of putting Palo Alto on the map with its public art. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Public Art Commission 5. Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No Lisa Waltuch Lisa Waltuch, 4/6/21 3XEOLF$UW&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\VRIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 3XEOLF$UW&RPPLVVLRQ 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Mark Weiss Mark Weiss 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 3XEOLF$UW&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH3XEOLF$UW&RPPLVVLRQ" BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RUSURIHVVLRQDO UHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I founded Earthwise Productions in 1994; in some ways it was a spin-off of Bay Area Action's Bay Area Earthday at Stanford, for which I volunteered. I produced 150 concerts at Cubberley, roughly twice a month for six years. The parent of an attendee, Gerald Brett suggested then I apply for the arts commission. I helped him hire a band called Monkey to play the unveiling of Marta Thoma's "Go, Mama" on Cali Ave. Between October, 2018 and March 13, 2020 I produced 18 concerts at Mitchell Park El Palo Alto Room. In 2009, Mayor Drekmeier recruited me to help Commissioner Ezran produce World Music Day. I later ran for City Council in 2009, 2012 and 2014. I've applied to four other boards or commissions a total of five times. I've likely spoken to boards and written to council on the arts, freedom of expression or The First Amendment 100 times. I'm an in-kind donor to The DeYoung Museum. I collect art. In 5th grade I was in the PAUSD student show, a work on paper, a water color depiction of King Tut flashing a peace sign. In 1982, for the Gunn Oracle, on April Fools' Day, along with future Academy Award winner Jessica Yu and future "Just Shoot Me" producer Marsh McCall, I creative-directed a series of photographs of "Jim Harbarph" dunking, cheering, chewing tobacco. Mark Weiss Gerald Brett, former Arts Commissioner Gunn High School, class of 1982 Dartmouth College, class of 1986 Palo Alto City Council, candidate for office, 2009, 2012, 2014 Palo Alto boards and commissions candidate five times, 2010-2017 Earthwise Productions (President) ✔ concert promoter / arts administrator / activist ✔ 3DJH 3XEOLF$UW&RPPLVVLRQ 2. Please describe an issue that recently came before the &RPPLVVLRQ that is of particular interest to \RXand describe why you are interested in it. $rchiveGYLGHRVDYDLODEOHIURPWKH0LGSHQ0HGLD &HQWHUFKDUDFWHUV 1. Wh\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH 3XEOLF$UW&RPPLVVLRQDQGZKDW experience ZRXOG \RXEULQJWRWKHSRVLWLRQ?FKDUDFWHUV I wrote a letter to the editor about We The People honoring Nathan Oliveira by purchasing Sons of the Golden West Building at 209 Hamilton which in the 1960s was a studio for artists and depicted in his "stage paintings". Council member Gail Price later read a proclamation into the record along similar themes. I support Percent for Art for public buildings only and not for private ones. I support performance arts as part of the Arts Commission purview. I like the graffiti at Greer Park skateboard facility even if it's not in the collection per se. I am wondering why there is no public art at the new garage on Sherman Avenue. I published on my blog the comp by Ala Ebtekar and Binta Ayofemi "Blue Tunnels" (2015) I think tax dollars should go towards more work like that of Greg Brown, Mohamed "Slim" Soumah, Joey Piziali, Chris Johanson, David Huffman, Peter Wegner, Sam Yates, Micheal Szabo, Bruce Beasley, Joan Zalenski, Nathan Oliveira, Joe Zirker, Stu Robertson, Fletcher Benton and Joe Sam. 3DJH 3XEOLF$UW&RPPLVVLRQ 4.3XEOLF$UW&RPPLVVLRQ0HPEHUVZRUNZLWKWKHGRFXPHQWOLVWHGEHORZ,I\RXKDYHH[SHULHQFH ZLWKWKLVGRFXPHQWSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWKWKLVGRFXPHQWLVQRW UHTXLUHGIRUVHOHFWLRQEXWZLOOKHOS\RXEHWWHUXQGHUVWDQGWKHZRUNRIWKHFRPPLVVLRQ FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ 3. If \RXDUHappointed, what specific goals would you like to see the3XEOLF$UW&RPPLVVLRQ achieve, and KRw would you KHOSLQWKHSURFHVV"FKDUDFWHUV I had written roughly 1,000 posts on my blog, Plastic Alto, during the time we were updating the Comp Plan. The name of my blog references jazz musician Ornette Coleman, who played an acrylic alto sax. Literally a plastic (not metal) alto (not tenor or baritone). The name also relates to the artificial turf soccer fields at Page Mill and El Camino and how different the game looks if you focus on those tiny, black fake pebbles that fly when the ball lands and not the ball per se, nor the players, the goal or the scoreboard. Could we self-govern better and have a more just society if we and especially our leadership thought regarding policy more like artists do? In some ways, and paradoxically, we would not need an arts commission then. Even when we disagree about the merits of a particular piece of public art in our collection -- or the value of the program as a whole -- that dialogue, discussion, debate or argument becomes, in a way, the commons, ours, something we share, Palo Alto. Much of my work comes out of a statement made by Donald Judd, the minimalist sculptor, to the SF Chronicle about how our ability to discern or to note small differences in art is crtical to our ability to self-govern and not be subjected to tyranny. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 3XEOLF$UW&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 3/15/2021 Mark Weiss Mark B. Weiss 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Stephanie MacDonald Stephanie MacDonald 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I have been a volunteer for Pets In Need since August 2018 at the Redwood City location. Pets In Need is a local animal shelter with locations in Redwood City and Palo Alto. As a dog volunteer, I walk dogs and provide enrichment and companionship. Since COVID-19, volunteer numbers have been limited, so I haven't been able to switch to the Palo Alto location after I moved cities, but I plan to volunteer there once it is safe to do so. I am also a volunteer with Peninsula for Everyone, a non-profit housing and transportation advocacy group. As a member, I partake in monthly meetings, am involved with community organizing, and speak at local meetings in support of various projects. Stephanie MacDonald As Senior Engineering Technician with the City of Foster City, I am directly involved with our stormwater pollution prevention program, in which I perform inspections as a Certified Stormwater Inspector for development sites and businesses in the City as required by our Municipal Regional Permit. I understand and implement our Enforcement Response Plan, and have direct field experience with stormwater management practices. I also help educate site reps and businesses of regulations and best practices. I assist in compiling the City's Annual Report to the Regional Water Board, and I partake in regular trainings. City of Foster City ✔ Senior Engineering Technician ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW I understand the implementation, purpose, and intent of the Stormwater Management Fee Ballot Measure and am able to interpret various regulatory and municipal documents. While I do not have much direct involvement with Storm Drain Master Plans, Sustainability and Climate Action Plans, or Green Stormwater Infrastructure Plans, I do understand much of the planning involved and I am aware of many of the implications and actions that come from these types of plans. I am familiar with City Annual Budgets, as I assist with aspects of the Foster City budget that pertain to my role. I am also Chief Shop Steward for the City's Union members, where I participate in bargaining and have a comprehensive understanding of our contract and the City's financial standings. Fostering communities that are healthy, sustainable, and conscious is a mission I strive to implement in both my personal and professional lives. I have been an advocate for conservation and the environment from a very young age, and I have always strived to do my part in preserving our natural surroundings. This commitment stays with me even stronger today, and it is what draws me to this exciting opportunity. I believe that my enthusiasm, along with my technical knowledge in stormwater best management practices, would make me a great fit for this opportunity. I possess a strong dedication to my work, and I would love to be a part of this committee to help preserve our natural networks in Palo Alto and the surrounding areas. Stephanie MacDonald 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/4/2021 Stephanie MacDonald Stephanie MacDonald Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org Storm Water Management Oversight Committee Personal Information -Note: The SWMOC meets on an as needed basis Name: Hal M Mickelson Address: Cell Phone: ~ome G ffice Phone: E-mail: uncleha lpaloalto@gmail.com Are you a Palo Alto Resident?@ YasQ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members?Q Yes @ No Are you available and committed to complete the term applied for? ®vas ~o California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Oves ®No Exduding your principal residence, do you or your spouse own real property in Palo Alto?Ovas®No Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, "No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual." This consent fotm will not be redacted and will be attached to the Application and posted to the City's website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: Q I give permission for the City of Palo Alto to post to the City's website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City's website. I am providing the following alternate information and request that they use the following contact information instead: Address: Post Office Box 20062, Stanford, California 94309 Cell Phone:650 868 2938 ~ome O office Phone: E-mail: unclehalpaloalto@gmail.com Hal M Mickelson Page 1 Storm Water Management Oversight Committee How did you learn about the vacancy on the Storm Water Management Oversight Committee? (Select more than one if applicable) Community Group Email from the City Palo Alto Weekly OoailyPost D City Website DFlyer Other: I'm a member of the Committee and was encouraged to re-apply. List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) I've served mutiple terms on the Storm Water Management Oversight Committee and its predecessors. I'm currently its Chair. I served on the Blue Ribbon Task Force that formulated the parcel fee proposal to fund Storm Water Management presented to the city's residents in 2017 and was a member of the campaign committee for the proposal. My undergraduate degree is from Stanford, A.B., 1971, and my law degree from Harvard, J.D., 1974. I practiced law for four years in San Francisco and for 37 years in Palo Alto as a member of the corporate legal staff at Hewlett-Packard. Active member, State Bar, No. 62132. Employment D Current Employer Employer: Hewlett-Packard Company Occupation: Corporate Counsel I.ti Last Employer Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) I'm a member, past president and past board member of the Rotary Club of Palo Alto; current board member for the Palo Alto History Museum; past board member for the Palo Alto Chamber of Commerce, Palo Alto Area Chapter of the American Red Cross and Stanford Daily Publishing Corporation. Hal M Mickelson Page2 Storm Water Management Oversight Committee 1. Why are you interested in serving on the Storm Water Management Oversight Committee? (1518 characters) Pm hoping that the expertise and insight that I've developed through past service on the Committee will continue to be useful to other committee members and the city staff. 2. Storm Drain Oversight Committee Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not reuired for selection. (1518 characters) 2017 Stormwater Management Fee Ballot Measure 2015 Storm Drain Master Plan Sustainability & Climate Action Plan (2020) Green Stormwater Infrastructure Plan (2019) City of Palo Alto Annual Budget I think it's fair for me to call myself an "author" of the 2017 Stormwater Management Fee Ballot Measure as one of the dozen or so people who served on the Blue Ribbon Task Force that formulated the measure. I've studied many years' worth of plans and budgets for the Storm Drain Utility Fund; I've participated in many reviews and discussions of Green Stormwater Infrastructure and staff plans and proposals relating to sustainability. Hal M Mickelson Page3 Storm Water Management Oversight Committee 3. Please confirm that you have read the Boards and Commissions Handbook: .®,ves Q No Signature: (Please type or sign) _H_al_M_. _M_ic_k_e_ls_o_n _____________ Date: April 6, 2021 Hal M Mickelson Page4 Stonn Water Management Oversight Committee Storm Water Management Oversight Committee Personal Information – Note: The 6:02& meets on an as needed Easis Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Page 1 Storm Water Management Oversight Committee Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Dena Mossar Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Storm Water Management Oversight Committee How did you learn about the vacancy on the Storm Water Management Oversight Committee? (Select more than one if applicable) __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Palo Alto City Council, 1998 - 2007 San Francisquito Creek Joint Powers Authority, Director, 1999 - 2007 Bay Conservation and Development Commission, Commissioner, 2005 - 2007 Bay Area Air Quality Management District, Director, 1999-2004 Bay Area Water Forum, Delegate, 2002 - 2007 Valley Transportation Authority, Director, 2002 - 2003 National League of Cities-Energy, Environment & Natural Resources Steering Committee, Member, 2001 - 2007 Storm Water Management Oversight Committee, Member and Vice-Chair, 2017 - 2021 Library Bond Oversight Committee, Member I am currently serving on this commi3ee see below City of Palo Alto City Council Member ✔ 2. Page 3 Storm Water Management Oversight Committee Storm Drain Oversight Committee Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not reuired for selection. (1518 characters) 1.Why are you interested in serving on the Storm Water Management Oversight Committee? (1518 characters) 2017 Stormwater Management Fee Ballot Measure 2015 Storm Drain Master Plan Sustainability & Climate Action Plan (2020) Green Stormwater Infrastructure Plan (2019) City of Palo Alto Annual Budget These are documents that I would have worked with as a member of the committee. I would like to con.nue my service on this commi5ee for a second term. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 4 Storm Water Management Oversight Committee 3.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No 4/3/2021Dena Mossar 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Catherine Perman Catherine Perman 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I participate and volunteer with Zohar Dance School (Cubberly Center). Worked as an election clerk in local and national elections. While my daughter was in Palo Alto schools (K-12) I volunteered in the classroom and with Palo Alto Community Child Care. Did some native plantings as volunteer with Save the Bay. I wish to increase my involvement in our community. Hence my application to the Stormwater committee. Catherine Perman Worked as environmental engineer. Pivoted to tech career in software engineering and management. Technical work: data analysis, financial compliance and systems security. Retired in 2019. Currently working on data science projects using open source tools. Ph.D. 1990, Stanford University, Stanford, California. Civil and Environmental Engineering. Improving the Performance of Wastewater Treatment Plants: an Expert Systems Approach M.S. 1984, Utah State University, Logan, Utah. Civil and Environmental Engineering B.A. 1975, Brown University, Providence, Rhode Island. Geology/Computer Science Endicia/Stamps.Com ✔✔ Engineer ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW •home native garden with some drainage issues. Learned about stormwater rebate program via installation of rain barrels arranged with drainage diversion away from house. Currently learning about the rain garden concept and possibilities for my yard. •attended a couple of webinars (during SIP) regarding green projects to increase wetlands water absorption and create flooding barriers in Baylands. •seeing programs in action along the Baylands. •with a stormwater drain at the corner of my property, I’m well aware of its various benefits and problems. For example, keeping leaves and debris from blocking drainage. Witnessing how repaving the street (good) changed drainage patterns (not so good). So city programs that aren’t directly stormwater related can impact stormwater infrastructure. * I have read the linked documents but never worked with them. I find stormwater related issues compelling. As an almost hidden aspect of urban infrastructure, stormwater management is rarely in the news until disaster strikes and impacts are apparent. So staying ahead of potential disasters is critical. Stormwater management directly aligns with my experience in project management, water resources, water quality and groundwater management. Much of my more recent hands-on experience is with data driven financial auditing. Reviewing capital improvement and monitoring expenditures align with my financial interests. Work done by the committee seems like an excellent fit and would give me an opportunity to contribute back to the Palo Alto community. Catherine Perman 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 Catherine Perman Catherine Perman 6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH 3HUVRQDO,QIRUPDWLRQ±1RWH7KH6:02&PHHWVRQDQDVQHHGHGEDVLV 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH Bob Wenzlau Bob Wenzlau 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU President, Neighbors Abroad Founder, Repair Cafe Member, Center for Pubic Environmental Oversight Zero Waste Block Leader Bob Wenzlau Existing Member Bachelor & Master Degree, Civil & Environmental Engineering, Stanford University Registered Civil Engineer, State of California (inactive registration) Member, Storm Water Management Oversight Committee Terradex, Inc. CEO, Civil/Environmental Engineer ✔ 2. 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 6WRUP'UDLQ2YHUVLJKW&RPPLWWHH0HPEHUVZRUNZLWKWKHGRFXPHQWVOLVWHGEHORZ,I\RX KDYHH[SHULHQFHZLWKDQ\RIWKHVHGRFXPHQWVSOHDVHGHVFULEHWKDWH[SHULHQFH([SHULHQFHZLWK WKHVHGRFXPHQWVLVQRWUHXLUHGIRUVHOHFWLRQFKDUDFWHUV 1.:K\DUH\RXLQWHUHVWHGLQVHUYLQJRQWKH6WRUP:DWHU0DQDJHPHQW2YHUVLJKW&RPPLWWHH" FKDUDFWHUV 6WRUPZDWHU0DQDJHPHQW)HH%DOORW0HDVXUH 6WRUP'UDLQ0DVWHU3ODQ 6XVWDLQDELOLW\ &OLPDWH$FWLRQ3ODQ *UHHQ6WRUPZDWHU,QIUDVWUXFWXUH3ODQ &LW\RI3DOR$OWR$QQXDO%XGJHW - Co-chair of Campaign for 2017 Stormwater Management Fee Ballot Measure - Presented Sustainability & Climate Action Plan to sister city, advised on solid waste elements. - Participated as member of Storm Water Oversight Committee in discussion and approval of the Stormwater Infrastructure Plan (2019) I am interested in supporting fiduciary oversight of annual dispersement of funds for stormwater management. Additionally, I am interested in supporting progress in green infrastructure as well as innovative programs including rainwater capture in residential sector. I also encourage broader engagement on the committee including use of art to develop engagement with our environment, as well as interaction with sister cities to bring fresh ideas to the oversight committee. I have supported staff in development of their web presence for these programs. Bob Wenzlau 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 6WRUP:DWHU0DQDJHPHQW 2YHUVLJKW&RPPLWWHH 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3/28/2021 Bob Wenzlau 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQJohn Bowie John Bowie 233 Sansome Street, Suite 400, San Francisco CA, 94104 408.868.8634 johnbowie77@gmail.com 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I am hoping to be more involved. We recently moved back to Palo Alto and I am hoping that I can be of service to the Utility Advisory Commission. John Bowie My background is in law and policy with a specific focus in grid modernization, renewables, demand response, climate mitigation and adaptation, and other regulated industries. My regulatory experience dates back to New York's Hurricane Sandy when I helped lead a coalition intervene to ensure that nearly $2B of ratepayer funds requested to rebuild the distribution grid would enable renewables and distributed resources. In California, I have worked on numerous energy issues, as well as water issues such as potable reuse, managed active recharge, and the Delta Conveyance Project negotiations. Kearns & West, Inc. ✔✔ Consultant, Public Policy and Community Engagement ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV Having been involved in a variety of aspects of utility processes, I love the forward looking nature of CPAU. The City consistently wins awards for its utility initiatives and it's very exciting to think about how I could contribute to that legacy. At the same time, we are confronting a unique moment in the history of utility infrastructure as wildfires are demanding us to reimagine how we build and operate our electric grid. Further compounding the issue, Covid has reshaped our society and drained public coffers. Climate change is creating unprecedented stress on water supplies and biodiversity. It is a daunting moment that we face but I hold a great deal of optimism that we can continue to imagine and innovate new ways through the challenge. I believe that my skills are well suited to the needs of the Utilites Advisory Commission. Having been involved in nonprofits, academic think tanks, and public and private sector companies in the regulated utility space, I can speak to a range of issues. Through these experiences, I have navigated a variety of subject matter issues involving electric utilities, water and groundwater, tech, telecommunications, and hazard mitigation. Finally, having worked as a public engagement professional, I understand the paramount importance of public process and the need to involve diverse voices in decision making. I hope that I can bring these skills into the service of the Utilities Advisory Commission and the people of Palo Alto. John Bowie I drafted the following as part of my fall application, so while not totally recent, it is still relevant. Electric vehicle charging infrastructure is an issue of particular interest that the Commission is contemplating. Combining electric utilities with transportation, GHG reductions, equity issues, and the blossoming electric vehicle industry is a fascinating subject. I think the depth of interest is how charger infrastructure is an essential component to fulfilling the EV transition and meeting climate mandates. The topic of charging infrastructure has received little fanfare compared to the vehicle transition but is absolutely critical to the success of transportation electrification. Charger companies face a variety of issues, such as tight ROIs with ~7-year payback periods on their infrastructure; technical challenges due to operating in an unsettled regulatory space (e.g. the location of charging ports on cars); and a need to build to a battery industry that is advancing at a breakneck pace. As regulators, EV charging infrastructure encompasses all these issues on balance with the public interest - how can a utility advance charging infrastructure in a way that accelerates the industry while also democratizing access to EVs? How can a utility proliferate charging infrastructure to meet new use cases, such as heavy-duty vehicles, electrifying ride share, or electrifying autonomous fleets? As a utility at the heart Silicon Valley, CPAU may be first to address many of these issues. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ If appointed, I would like to see the Utilities Advisory Commission further CPAUs success on climate mitigation efforts. Specifically, the role of utilities in transportation electrification is still being defined. Full decarbonization of our economy depends on advances in how electricity is procured and delivered. In particular, I believe there are creative ways of pricing energy resources, such as geographic time of use rates to complement locational marginal pricing, EV fleet operator public charger commitments, and pilot programs with companies to advance nascent technologies. In addition, I would also like to see CPAU further advance electrification efforts for multi-family housing and otherwise EV-underserved populations. In order to achieve wider goals of decarbonization, utilities must pave paths for these communities to adopt carbon-neutral technologies at affordable rates and convenient times. Equity must be an element of our climate plans looking to the future. There will be particular issues around this as the "air conditioning belt" climbs north due to climate change, and our electric system adapts to greater loads. Dovetailing with electrification efforts to reduce CO2 GHGs, there must also be efforts to reduce or limit natural gas. There are several possible initiatives in this space, including identifying and reducing system leakage (or determining ways to account for it), transitioning existing gas uses to electric, and procuring gas from novel regenerative sources. CPAU is already making progress on these issues and I would love to be a part of that process. John Bowie I do not have specific experience with any of these documents but I have been involved in similar efforts in other jurisdictions. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/6/2021 John Bowie John Bowie 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQCarol H Guthrie Carol H Guthrie 3061 Bryant St cohgcohg@gmail.com 650.855.9072 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Board Member and Officer for Peninsula Youth Ballet, a 501 (c) (3) not for profit corporation since 2007. - Reformed financial and budgeting systems to restore fiscal continuity and compliance. - Successfully funded and presented full-length ballet productions of The Nutcracker. - Managed logistics for auditions, casting, rehearsals, marketing, ticketing, and performances. Carol H Guthrie Spouse saw the opening and felt my experience was relevant. Chaired the Electricity Consumer's Resource Council (ELCON). First industrial representative elected to NERC Board of Trustees; task force member transforming NERC to ERO under FERC. Developed policies advocating and implementing competition in natural gas transportation and restructuring the vertically integrated electric industry. Negotiated, structured, and drafted long term contracts for commodity supply, services, and tolling arrangements (US $2.8 Billion). Provided subject matter expertise, market and risk analysis, decision analysis and investment guidance for utilities capital investment. Stanford University, Stanford Humanities Center Humanities Research Workshop Manager ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV The majority of my professional life was spent in the energy and natural resources industry. Following early retirement, I accepted a job at the Stanford Humanities Center mentoring advanced graduate students. While I am enjoying my role and becoming reacquainted with the Humanities, I am more aware than most of the challenges facing California, particularly in the Bay Area and its cities, to repair, replace, upgrade and fund its energy and water infrastructure. Immediately following my departure from Chevron I accepted a short-term consulting role to support a nascent group attempting to develop strategies to mitigate portfolio exposure, integrate more renewable energy, and accommodate increasing energy efficiency. Since that time natural events such as wildfires and floods have exacerbated the complex and often competing demands on state and local governments to secure safe, reliable, and renewable energy while ensuring availability of critical commodities such as electricity and water at reasonable rates. Over the course of my career I worked on water rights, dam re-licensing, cogeneration facilities, transmission infrastructure projects for both gas and electricity, and the governing laws and regulations. I believe my experience would be useful in this type of an advisory role. Carol H Guthrie I am interested in better understanding the underlying rationale for the assumptions of declining electricity usage suggested in the FY22 Electric Financial Plan and the relationship between the electric and gas assumptions. In light of the assumed trend to electric households and cars and movement away from natural gas and fossil fuels the demand for flexibility in the electricity system will increase. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ Renewable energy will play a continuing role in utility portfolios, recent events in CA and elsewhere suggest a continued need for some generation reserves with greater flexibility e.g. natural gas generators. PA renewable programs appear aimed at commercial users. I am interested in PA plans to educate and engage retail, household stakeholders in supply, transmission, and distribution issues and programs associated with availability and cost of energy and water. Availability encompasses planning for disruptions such as the utilities and CAISO power outages to manage wildfires and potential longer term impacts on clean water and all infrastructure - gas, water, and electric. In recent years we have experienced numerous unprecedented events which are still being analyzed and understood. While managing recovery from the pandemic and resumption of activities for a "new normal", scenario planning has an important role. I would like to ensure PA does not rely only on traditional resource planning and uses scenario and risk based decision analysis. Carol H Guthrie I have not had experience with PA specific plans; however, throughout my career I engaged in analyzing, commenting and engaging in proceedings through ad hoc advocacy groups on plans such as these with numerous utilities - IOU, municipal and other - at the state and federal level. I managed and planned for the energy requirements for large industrial consumers and generators and commercial consumers of all sizes ranging from large buildings to pump stations, and service stations. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/2/2021 Carol H Guthrie Carol H. Guthrie 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQDonald Clark Jackson Donald Clark Jackson Post Office Box 986, Palo Alto, CA, 94302-0986 dcj+uac-public@clark-communications.com +1.408.395.3516 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU I've been a UAC commissioner since June of 2019. I spend a significant amount of time researching many of the issues that come before the UAC. I undertook a leadership role in support of, and advocating for, the CPAU Staff proposal to raise millions of dollars (in a carbon-neutral manner) through REC sales/exchanges, I collaborated with a fellow commissioner and Staff, ultimately both UAC and Council voted unanimously to approve this program. More recently, I authored a detailed list of questions and suggestions regarding systemic obstacles to residential electrification projects due to potentially outdated building codes, which I have shared with the Directors of Planning and CPAU, the UAC, and the public, in preparation for an upcoming UAC agenda discussion on this topic. For the past 3+ years, I’ve worked on a volunteer basis in collaboration with resident T.C. Rindfleisch and Stanford Professor J.J. Alonso on a project to measure, collect, analyze, and report on aircraft traffic and the resulting ground noise, our goals are to provide factual, objective data to inform discussions and debate on this topic. Last year our project was awarded a grant by the FAA to fund student research, and I presented an overview of our work at the 2020 Aviation Noise & Emissions Symposium. Donald Clark Jackson CPAU Email I graduated with a double major in electrical engineering and computer science from Vanderbilt University in 1980, moved to Silicon Valley, worked for a variety of companies, currently semi-retired. I was appointed to fill a vacancy on the UAC in 2019. As a commissioner, I have invested considerable time and effort to educate myself on the topics of electrification, the City’s S/CAP goals, and details of both the electric and fiber utilities. One consequence: I've begun electrifying my own home (in progress), in order to “lead by example”, and I hope to use my experience to benefit the community DriveScale Corporation Computer Engineer/Programmer ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV I’m extremely concerned about climate change, and through my work with the UAC, I’ve learned about the dangers of natural gas, and the need for decarbonization/electrification, and I want to continue to work with Council, Staff, and UAC on our S/CAP goals. I have worked for 40+ years as a Silicon Valley engineer, and I have extensive experience making products and services “happen”, which will continue to be one valuable perspective to have on the UAC, both in general, and specifically in regard to AMI, Fiber, cybersecurity, and electrification projects. I’ve been fascinated with “infrastructure” for many years, initially focused on telecommunications/Internet, and more recently, energy. My interests extend beyond technology and include policy and economics. I’ve submitted comments to the FCC on several issues and am currently working on comments on a FAA noise study. Donald Clark Jackson Generally speaking, at each UAC meeting held since my appointment, there have been one (or more) topics of considerable interest to me, including: • Utility supply planning/agreements (especially electricity and water) • Renewable Energy Credit (REC) exchanges/sales • S/CAP update, goals and process • Extending building “Reach” codes to require electrification • Integration of DERs in Palo Alto • Demand Side Management And many others… Council representatives to the UAC during my tenure (DuBois, Cormack, and Filseth) have direct experience with my preparation, engagement, and passion, not to mention my perfect attendance record, at UAC meetings. An upcoming (April?) topic of great interest is a discussion regarding the impact of the City’s building codes, permitting and inspection processes on residential electrification, PV, and ESS projects. In preparation for that meeting, I authored a detailed list of questions and suggestions for improvement, based on both community input, and my personal experience. I will attach a copy of that document to my application for your reference, as an example of the effort I make on a topic of interest. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ Clearly the UAC’s first and highest priority is to continue to support CPAU and Council maintain, modernize, and improve our existing services (electricity, water, gas). If Palo Alto is to meet our ambitious S/CAP goals, we’ll need to address the electrification of both residences and commercial buildings, including the replacement (over time) of existing natural-gas appliances (water heaters, furnaces, stoves). We need to decide as a community what steps we are actually willing to undertake, and over what timeframe. When I joined the UAC two years ago, I had absolutely no understanding of the environmental impact of natural gas use, and I’m very concerned that the vast majority of residents remain oblivious to this issue, including the costs of electrification. “On-utility-bill” financing of electrification related replacement costs will likely be an important tool. Our building codes and planning processes must be modernized to ease the implementation of electrification projects, in my experience, our current building codes actively discourage and inhibit them. Shelter-in-place due to the Covid-19 pandemic has demonstrated the viability and need for remote work and schooling, but also highlighted the limitations of our existing Internet infrastructure. I hope that the plans and reports resulting from Phase 3 of CPAU’s Fiber Expansion project will give us the context and foundation we need to commit to fiber-to-the-premise for all Palo Alto residents and businesses. Raising the money to undertake this effort will be challenging, taking a bond measure to a public vote may well be required. Donald Clark Jackson I have some familiarity with several of these documents, typically I read/study them on an “as-needed” basis in preparation for related UAC agenda topics. I feel that over the past two years, I have consistently demonstrated my thorough preparation and research for a majority of UAC agenda topics, and that the Council representatives to the UAC over my tenure are in a good position to provide an assessment of my contributions to the entire Council, as you consider me for re-appointment. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 2021-03-07 Donald Clark Jackson Donald Clark Jackson 8WLOLWLHV$GYLVRU\&RPPLVVLRQ 3HUVRQDO,QIRUPDWLRQ±1RWH7KH8$&UHJXODUO\PHHWVWKHILUVW:HGQHVGD\RIWKHPRQWKDW30 1DPH $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO $UH\RXD3DOR$OWR5HVLGHQW"BB<HVBB1R 'R\RXKDYHDQ\UHODWLYHVRUPHPEHUVRI\RXUKRXVHKROGZKRDUHHPSOR\HGE\WKH&LW\RI3DOR$OWRZKR DUHFXUUHQWO\VHUYLQJRQWKH&LW\&RXQFLORUZKRDUH&RPPLVVLRQHUVRU%RDUG0HPEHUV"BB<HVBB1R $UH\RXDYDLODEOHDQGFRPPLWWHGWRFRPSOHWHWKHWHUPDSSOLHGIRU"BB<HVBB1R &DOLIRUQLDVWDWHODZUHTXLUHVDSSRLQWHGERDUGDQGFRPPLVVLRQPHPEHUVWRILOHDGHWDLOHGGLVFORVXUHRI WKHLUILQDQFLDOLQWHUHVWV)DLU3ROLWLFDO3UDFWLFHV&RPPLVVLRQ&RQIOLFWRI,QWHUHVW)RUP 'R\RXRU\RXUVSRXVHKDYHDQLQYHVWPHQWLQRUGR\RXRU\RXUVSRXVHVHUYHDVDQRIILFHURUGLUHFWRU RIDFRPSDQ\GRLQJEXVLQHVVLQ3DOR$OWRZKLFK\RXEHOLHYHLVOLNHO\WR HQJDJHLQEXVLQHVVZLWKWKH&LW\ SURYLGHSURGXFWVRUVHUYLFHVIRU&LW\SURMHFWVRU EHDIIHFWHGE\GHFLVLRQVRIWKHERDUGRUFRPPLVVLRQ\RXDUHDSSO\LQJIRU"BB<HVBB1R ([FOXGLQJ\RXUSULQFLSDOUHVLGHQFHGR\RXRU\RXUVSRXVHRZQUHDOSURSHUW\LQ3DOR$OWR"BB<HVBB1R 33OHDVHHPDLODOOFRPSOHWHGDSSOLFDWLRQVWR-HVVLFD%UHWWOH#&LW\RI3DOR$OWRRUJRU&LW\&OHUN#&LW\RI3DOR$OWRRUJ &DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQVWDWHVLQSDUW³1RVWDWHRUORFDODJHQF\VKDOOSRVWWKHKRPH DGGUHVVRUWHOHSKRQHQXPEHURIDQ\HOHFWHGRUDSSRLQWHGRIILFLDORQWKH,QWHUQHWZLWKRXWILUVWREWDLQLQJWKH ZULWWHQSHUPLVVLRQRIWKDWLQGLYLGXDO´This consent form will not be redacted and will be attached to the Application and posted to the City’s website. )RUWKHIXOOFRGHUHYLHZWKH&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 5HDGWKHFRGHDQGFKHFNRQO\21(RSWLRQEHORZ ,JLYHSHUPLVVLRQIRUWKH&LW\RI3DOR$OWRWRSRVWWRWKH&LW\¶VZHEVLWHWKHDWWDFKHG%RDUGDQG &RPPLVVLRQ$SSOLFDWLRQLQWDFW,KDYHUHDGDQGXQGHUVWDQGP\ULJKWVXQGHU*RYHUQPHQW&RGH 6HFWLRQ,PD\UHYRNHWKLVSHUPLVVLRQDWDQ\WLPHE\SURYLGLQJZULWWHQQRWLFHWRWKH3DOR $OWR&LW\&OHUN 25 ,UHTXHVWWKDWWKH&LW\RI3DOR$OWRUHGDFWP\KRPHDGGUHVVSKRQHQXPEHUVDQGHPDLODGGUHVV IURPWKHDWWDFKHG%RDUGDQG&RPPLVVLRQ$SSOLFDWLRQSULRUWRSRVWLQJWRWKH&LW\¶VZHEVLWH ,DPSURYLGLQJWKHIROORZLQJDOWHUQDWHLQIRUPDWLRQDQGUHTXHVWWKDWWKH\XVHWKHIROORZLQJ FRQWDFWLQIRUPDWLRQLQVWHDG $GGUHVV &HOO3KRQH BB+RPHBB2IILFH3KRQH (PDLO &RQVHQWWR3XEOLVK3HUVRQDO,QIRUPDWLRQRQWKH&LW\RI3DOR$OWR:HEVLWH 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQPhil Metz Phil Metz 650-494-6588 'HVFULEH\RXULQYROYHPHQWLQFRPPXQLW\DFWLYLWLHVYROXQWHHUDQGFLYLFRUJDQL]DWLRQVFKDUDFWHUV 3DJH 8WLOLWLHV$GYLVRU\&RPPLVVLRQ +RZGLG\RXOHDUQDERXWWKHYDFDQF\RQWKH8WLOLWLHV$GYLVRU\&RPPLVVLRQ" 6HOHFWPRUHWKDQRQHLIDSSOLFDEOH BB&RPPXQLW\*URXS BB(PDLOIURPWKH&LW\ BB3DOR$OWR:HHNO\ BB'DLO\3RVW BB&LW\:HEVLWH BB)O\HU 2WKHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /LVW UHOHYDQW HGXFDWLRQ WUDLQLQJ H[SHULHQFH FHUWLILFDWHV RIWUDLQLQJ OLFHQVHV RU SURIHVVLRQDOUHJLVWUDWLRQFKDUDFWHUV (PSOR\PHQW (PSOR\HU 2FFXSDWLRQ &XUUHQW(PSOR\HU/DVW(PSOR\HU Since 2017 my full-time focus has been environmental sustainability & climate change. In 2020, together with a group of scientists, economists, investment experts and corporate executives, I co-founded the BioPhysical Economics Institute (BPEI). BPEI is a non-partisan non-profit organization working to bring the natural sciences into economic analysis and financial decision making. Especially, BPEI aims to incorporate the analysis of energy into strategies for reducing our reliance on fossil fuels, while supporting our natural habitats. From 2018-2019 I was a Research Fellow at Project Drawdown, geared to helping the world reach “Drawdown” of atmospheric greenhouse gases. Since 2017 I have been a Palo Alto emergency services volunteer (ESV), trained as both a block preparedness coordinator (BPC) and as a community emergency response team (CERT) volunteer. For CPAU, I have participated in 2 Utility Resilience Workshops. Since 2018 I have volunteered as a mentor with the International Rescue Committee (IRC) to help immigrants obtain jobs in the US. Since 2018, I have volunteered with social justice organization Bend the Arc. In the 2020 election I was an active member of Clean Energy for Biden and led a phone banking team in Wisconsin. Phil Metz Education: • PhD in physics • MBA in marketing Experience: • Co-founder and Director, BioPhysical Economics Institute (2020-present) • Research Fellow, Project Drawdown (2018-2019) • 7 years as sustainability consultant and researcher • 10+ years of R&D in energy efficiency and renewable energy, including electric heat pumps, cool / green roofs, solar, and community energy systems • 16 years consulting for energy-related businesses, including electric utilities • 6 years as renewable energy business development executive • 3 years as Palo Alto emergency services volunteer, both as BPC and as CERT BioPhysical Economics Institute ✔ ✔✔ Director ✔ 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why?FKDUDFWHUV 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHUFKDUDFWHUV My interest in the UAC is applying my experience in biophysical economics, physics, engineering, renewable energy, and building energy systems to help right Palo Alto’s misguided sustainability plans: 1. Improve Palo Alto’s environmental sustainability strategy and impacts. The City relies primarily on remotely generated renewable energy and “Bucket 3” renewable energy certificates (RECs) to “reduce” its GHG emissions. But RECs, as financial instruments, have no energy or GHG impact. The real challenge of renewable energy is delivering electricity when and where it is needed. Bucket 3 RECs pertain to energy delivered somewhere else and at a different time (not necessarily even the same year). As such Bucket 3 RECs do not represent renewable energy used by Palo Alto. In fact, the purchase of such RECs actually retards the transition to renewable electricity (Pinkel & Weinrub 2013) by diverting money from the purchase of real renewable energy delivered where and when it is needed. 2. Use objective biophysical criteria for selecting and evaluating utility plans. I discuss an example, application of energy return on energy investment (EROI) for evaluating Palo Alto’s building electrification plan in #3 below. 3. Improve utility resilience and emergency response. The 2019 and 2020 wildfires and blackouts show how vulnerable the City is to an electricity supply disruption. RECs, as financial instruments, contribute nothing to increase utility resilience or emergency response. Phil Metz The #1 issue I see is providing reliable renewable energy. Over the past year UAC has evaluated PAU’s renewable energy strategy, SCAP, REC exchange, and building electrification. But the core challenge is reliably delivering renewable electricity in the right amount to the right place at the right time. “Financial engineering” via REC exchange, does not address this challenge. And PAU’s strategy of relying on the grid to deliver remotely produced renewables, will increasingly fail the reliability test. CAISO’s analysis of the August 2020 blackouts concluded that “resource planning targets have not kept pace to lead to sufficient resources that can be relied upon to meet demand in the early evening hours”. Make no mistake: Grid reliability will get worse. More frequent heat waves will increase energy demand and reduce supply, even as the grid becomes more renewable – hence more difficult to manage. PAU has fostered residential PV systems and electric vehicles (EVs). But most PV systems cease operation when the grid is down and commercial EVs cannot return stored energy to the grid. So, both are useless when the grid is down, or in an emergency. In short, to deliver reliable renewable energy PAU must be proactive in generating and delivering the renewable energy it needs. We need to develop local renewables as part of a strategy that integrally connects energy generation, delivery, and end use, and that anticipates emergencies. 3. If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this?FKDUDFWHUV 3DJH 8WLOLW\$GYLVRU\&RPPLVVLRQ 4. Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection.FKDUDFWHUV 7KH8WLOLWLHV6WUDWHJLF3ODQ 7KH/RQJ7HUP(OHFWULF$FTXLVLWLRQ3ODQ 7KH*DV8WLOLW\/RQJWHUP3ODQ 8UEDQ:DWHU0DQDJHPHQW3ODQ 7HQ<HDU(OHFWULF(QHUJ\(IILFLHQF\3ODQDQG7HQ<HDU1DWXUDO*DV(QHUJ\(IILFLHQF\3ODQ 6XVWDLQDELOLW\DQG&OLPDWH$FWLRQ3ODQ6&$3 )LEHUWRWKH3UHPLVH0DVWHU3ODQ The top goals I would like to see UAC achieve are: 1. Deliver “real” renewable energy that matches PAU’s load second-by-second. That means proactively reducing PAU’s dependence on remote renewables and RECs with a holistic strategy that dramatically increases energy efficiency, demand response, and local distributed energy resources. 2. Apply objective biophysical metrics, such as EROI, to PAU energy-related decisions. Building electrification is an example: Jettisoning natural gas distribution in residential neighborhoods by 2030, forcing homeowners to replace still-functional gas-fired equipment with new electrical equipment, could actually increase GHG production (and reduce resilience): The stranded gas equipment and replacement electrical equipment represent large embodied energy – and GHG. It is essential to evaluate the real emissions impact, including these GHG sources, using metrics such as “energy return on energy investment” (EROI). “Scope 3 emissions”, also currently ignored, provide another example. We must “do the math” to ensure that we don’t increase GHG emissions in the name of sustainability. 3. Incorporate resilience and emergency response in utility decision making. With Palo Alto’s complete dependence on an unreliable grid for its electricity supply, resilience needs to be a more important consideration in PAU’s planning. Local renewable energy generation and enhanced building energy conservation warrant deeper exploration. Especially, Palo Alto needs to ensure minimum habitability during an emergency so that residents can safely shelter in place. Phil Metz I am very familiar with the Utilities Strategic Plan, the Long Term Electric Acquisition Plan, and other documents, such as the FY 2019 Electric Utility Financial Plan and Rate Proposal, in connection with my participation in two City of Palo Alto Utilities Advisory Commission Resilience Workshops. I have formally submitted (April 9, 2020) recommendations for improving the SCAP: 1. Greatly enhance community involvement and input in the planning process. 2. Develop a holistic plan that simultaneously addresses GHG reduction, increased resilience, and enhanced emergency response. 3. Close the gaps in transportation and “Scope 3” emissions. Related, I have urged (August 17, 2020) that City Council reject staff recommendations related to the exchange and purchase “Bucket 3” RECs, and instead focus its resources on a renewable energy plan that actually generates renewable energy and reduces energy consumption. That will reduce GHG production, increase resilience, and enhance emergency response. 6LJQDWXUH3OHDVHW\SHRUVLJQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBB 3DJH 8WLOWLHV$GYLVRU\&RPPLVVLRQ 3OHDVHFRQILUPWKDW\RXKDYHUHDGWKH%RDUGVDQG&RPPLVVLRQV+DQGERRNBBB<HVBBB1R 4/5/21 Phil Metz Phil Metz Utilities Advisory Commission Personal Information – Note: The UAC regularly meets the first Wednesday of the month at 4:00 P.M. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests (Fair Political Practices Commission, Conflict of Interest, Form 700). Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. For the full code, review the California Government Code Section 6254.21 Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Consent to Publish Personal Information on the City of Palo Alto Website Page 1 Utilities Advisory CommissionRajmohan Rajagopalan Rajmohan Rajagopalan Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Page 2 Utilities Advisory Commission How did you learn about the vacancy on the Utilities Advisory Commission? (Select more than one if applicable) __ Community Group __ Email from the City __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Employment Employer: Occupation: Current Employer Last Employer Board Member experience at Ecochallenge.org. Member of Kiss The Ground community, focused on reversing climate change. Climate change activist (educating myself and donating time and money to various causes) Rajmohan Rajagopalan Planning to take courses in Foothill college focused on renewable energy, clean tech, regenerative farming. Atlassian 4 4 Vice President/Head of Product Management 4 Page 3 Utility Advisory Commission 1. What is it about the Utilities Advisory Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center. (1518 characters) As mentioned above, I'm a climate activist. I own two homes (one in Palo Alto and one in Seattle) that is fully powered by solar panels and drive only electric cars for the last 4 years. I see a ton of opportunity to make an impact in a forward thinking and looking charter city and highly educated and open minded residents of Palo Alto. Rajmohan Rajagopalan Staff Recommendation That the Utilities Advisory Commission Recommend the City Council Approve 10 Year Energy Efficiency Goals for 2022-2031 - https://cityofpaloalto.org/civicax/filebank/documents/80386 This is of particular interest to me, given the progress we need to make to get to carbon neutral by 2050 to reverse the climate change and avoid a climate disaster. If citiies like Palo Alto can't achieve this and act as a role model for California/US and the world, we just dont have any hope we can get to carbon neutral and reverse the climate change. 3.If appointed, what specific goals would you like to see the Utilities Advisory Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 4 Utility Advisory Commission 4.Utilities Advisory Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (1035 characters) The Utilities Strategic Plan (2018) The Long Term Electric Acquisition Plan (2012) The Gas Utility Long-term Plan (2017) Urban Water Management Plan (2016) Ten-Year Electric Energy Efficiency Plan and Ten-Year Natural Gas Energy Efficiency Plan (2012) Sustainability and Climate Action Plan (SCAP) Fiber-to-the-Premise Master Plan (2015) I'd like to see the commission adopt more forward looking policies and provide incentives to the residents to take responsiblity for their actions, and aware of the role that each and everyone has to play in consuming less (conserve energy, recycle water), producing more (solar and other energy sources). I think the City can have a big impat on how the residents behave and take even more responsibility. Rajmohan Rajagopalan I don't have specific experience. But I love Palo Alto (recently moved from Seattle and setteld here) and I want to contribute my time and energy, skills (tech, growth mindset) to make solid progress in this area. Signature: (Please type or sign) _______________________________________________ Date: _____________ Page 5 Utilties Advisory Commission 5.Please confirm that you have read the Boards and Commissions Handbook: ___Yes ___ No 03/22/2021 Rajmohan Rajagopalan Rajmohan Rajagopalan CITY OF PALO ALTO OFFICE OF THE CITY CLERK April 19, 2021 The Honorable City Council Attention: Finance Committee Palo Alto, California Approval of Action Minutes for the April 5, 2021 City Council Meeting Staff is requesting Council review and approve the attached Action Minutes. ATTACHMENTS: • Attachment A: 04-05-21 CCM DRAFT Action Minutes (DOCX) Department Head: Beth Minor, City Clerk Page 2 CITY COUNCIL MEETING DRAFT ACTION MINUTES Page 1 of 5 Special Meeting April 5, 2021 The City Council of the City of Palo Alto met on this date in virtual teleconference at 5:01 P.M. Participating Remotely: Burt, Cormack, DuBois, Filseth, Kou, Stone, Tanaka Absent: Study Session 1. Report and Discussion Regarding Police Services, Including Policy Updates, Crime Statistics, Radio Encryption, and Independent Auditing. NO ACTION TAKEN Council took a break at 6:41 P.M. and returned at 6:50 P.M. 2. Discussion of Services for the Unhoused in Palo Alto. NO ACTION TAKEN Agenda Changes, Additions and Deletions None. Council took a break at 9:22 P.M. and returned at 9:32 P.M. Minutes Approval 1. Approval of Action Minutes for the March 15 and March 22, 2021 City Council Meetings. MOTION: Council Member Cormack moved, seconded by Mayor DuBois to approve the Action Minutes for the March 15 and March 22, 2021 City Council Meetings. MOTION PASSED: 7-0 DRAFT ACTION MINUTES Page 2 of 5 (Sp.) City Council Meeting Draft Action Minutes: 04/05/2021 Consent Calendar MOTION: Council Member Cormack moved, seconded by Council Member Kou to approve Agenda Item Numbers 4 and 5. 4. Approval of the Traffic Data Collection Surveillance Use Policy and Approval of a Contract With Traffic Data Service, Inc. for a Total Not-to-Exceed Amount of $200,000 to Provide On-call Traffic Data Collection Services. 5. Ordinance 5519 Entitled, “Ordinance of the Council of the City of Palo Alto Adopting an Administrative Amendment to the 2019 California Fire Code, Palo Alto Municipal Code Section 15.04.075 (Definitions Added to Section 202) (FIRST READING: March 15, 2021 PASSED: 7-0).” MOTION PASSED: 7-0 Action Items 6. Discussion and Selection of Members for an Advisory Housing Element Working Group to Assist With the Preparation of a new Housing Element. MOTION: Council Member Filseth moved, seconded by Council Member Stone to: A. Appoint a Housing Element Working Group as follows: i. Appoint the following people to the Working Group: 1. Anupa Bajwa 2. Sheena Chin 3. Aishetu Fatima Dozie 4. Hamilton Hitchings 5. Rahsan Hosgur Karahan 6. Kathryn Jordan 7. Arthur Keller 8. Sheryl Klein 9. Ed Lauing 10. Jennifer Liu 11. Pat Markevitch 12. Keith Reckdahl DRAFT ACTION MINUTES Page 3 of 5 (Sp.) City Council Meeting Draft Action Minutes: 04/05/2021 13. Jean Snider 14. Jessenia Solorio 15. Randolph Tsien ii. Appoint the following people as Alternates: 1. Jessica von Borck 2. Dina Bartello B. Direct Staff to coordinate a joint City Council and Planning and Transportation Commission Housing Element Kick Off Meeting, tentatively scheduled for May 10, 2021. AMENDMENT: Council Member Kou moved, seconded by Council Member XX to replace Jean Snider with Arthur Liberman. AMENDMENT FAILED DUE TO THE LACK OF A SECOND SUBSTITUTE MOTION: Council Member Cormack moved, seconded by Council Member XX to: A. Appoint a Housing Element Working Group as follows: i. Appoint the following people to the Working Group: 1. Jessica von Borck 2. Antonia Mendoza 3. Donald Barr 4. Jessenia Solorio 5. Gregg Johnson 6. Kevin Ma 7. Helen Carnes 8. Robert Chun 9. Aishetu Fatima Dozie 10. Lisa Ratner 11. Keith Reckdahl 12. Jessica Resmini 13. Cara Silver 14. Mele Tupou DRAFT ACTION MINUTES Page 4 of 5 (Sp.) City Council Meeting Draft Action Minutes: 04/05/2021 15. Brigham Wilson ii. Appoint the following people as Alternates: 1. Peter Baltay 2. Raven Malone SUBSTITUTE MOTION FAILED DUE TO THE LACK OF A SECOND SUBSTITUTE MOTION: Council Member Tanaka moved, seconded by Council Member Cormack to direct the City Council to email their selections to the City Clerk to be tallied for majority prior to appointment. SUBSTITUTE MOTION FAILED: 3-4 DuBois, Filseth, Kou, Stone no AMENDMENT: Vice Mayor Burt moved, seconded by Council Member Cormack to add Cara Silver, Daniel Mendez, Raven Malone, Jessica Resmini and Justine Burt to the Motion Part A. i. for the purpose of voting to appoint members to the Housing Element Working Group. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add Steven Levy to the list. AMENDMENT RESTATED: Vice Mayor Burt moved, seconded by Council Member Cormack to add Cara Silver, Daniel Mendez, Raven Malone, Jessica Resmini, Justine Burt, and Stephen Levy to the Motion Part A. i. for the purpose of voting to appoint members to the Housing Element Working Group. AMENDMENT FAILED: 3-4 Dubois, Filseth, Kou, Stone no MOTION RESTATED: Council Member Filseth moved, seconded by Council Member Stone to: A. Appoint a Housing Element Working Group as follows: i. Appoint the following people to the Working Group: 1. Anupa Bajwa 2. Sheena Chin 3. Aishetu Fatima Dozie 4. Hamilton Hitchings 5. Rahsan Hosgur Karahan 6. Kathryn Jordan DRAFT ACTION MINUTES Page 5 of 5 (Sp.) City Council Meeting Draft Action Minutes: 04/05/2021 7. Arthur Keller 8. Sheryl Klein 9. Ed Lauing 10. Jennifer Liu 11. Pat Markevitch 12. Keith Reckdahl 13. Jean Snider 14. Jessenia Solorio 15. Randolph Tsien ii. Appoint the following people as Alternates: 1. Jessica von Borck 2. Dina Bartello B. Direct Staff to coordinate a joint City Council and Planning and Transportation Commission Housing Element Kick Off Meeting, tentatively scheduled for May 10, 2021. MOTION PASSED: 4-3 Burt, Cormack, Tanaka no Adjournment: The meeting was adjourned in honor of the Stanford Women’s Basketball Championship at 11:28 P.M. 1 Brettle, Jessica From:Rice, Danille Sent:Thursday, April 15, 2021 6:43 PM To:Council, City; Council Agenda Email Cc:Executive Leadership Team; ORG - Clerk's Office Subject:Council Agenda Consent Questions for April 19, Item 4 Dear Mayor and Council Members: On behalf of City Manager Ed Shikada, please find below the staff responses to inquiries made by Council Member Cormack in regard to the April 19, 2021 Council Meeting agenda. Item 4: JMZ Exhibit Agreement, Grant Acceptance/Budget Amendment, Donor Recognition, & License with Stanford 1. Can you please more fully explain the benefit to visitors and staff of having Stanford psychology research on site? How often would research be conducted and might it feel intrusive to visitors to be asked to participate? The JMZ partnership with Stanford’s Psychology Department directly supports JMZ’s strategic goal to be a thought leader in early childhood education. Partnering with Stanford affords us the opportunity to shape and learn from early childhood learning research. It will help our educators better understand how children learn, how to more effectively teach them, and is also tied to our mission of “engaging a child’s curiosity in science and nature.” The partnership helps us connect with and attract high quality museum and education professionals, interns and volunteers. Additionally, such partnerships help attract funding, especially from large funders like the Institute for Museum and Library Services and the National Science Foundation. In terms of process and frequency of research activity, Stanford students spend time at the Museum 3 days a week for 2‐3 hours either in the morning or afternoon. Through visible signage, they let visitors know of the opportunity to participate and they let visitors self‐select to participate. That is, they let visitors approach them rather than the other way around. During previous activity, JMZ families showed interest in what the researchers were doing and many were happy to participate. To provide a quiet and private space, Stanford will use a small room at the Museum to conduct their research, however; if the City has a need to use this space, staff will coordinate with Stanford prior to use to ensure there are no scheduling conflicts. Thank you. 2 Danille Rice Executive Assistant to the City Manager (650) 329‐2105 | danille.rice@cityofpaloalto.org www.cityofpaloalto.org City of Palo Alto (ID # 12071) City Council Staff Report Report Type: Consent Calendar Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: JMZ Exhibit Agreement, Grant Acceptance/Budget Amendment, Donor Recognition, & License with Stanford Title: Approval of: 1) Professional Services Agreement With Blue Rhino Studio, Inc. in the Amount of $214,706 for Dinosaur Exhibits for the Junior Museum and Zoo (JMZ); 2) Accept a $14,325 Christopher & Dana Reeve Foundation Grant for Adult Changing Tables at the JMZ; 3) Approve a Budget Amendment in the Capital Improvement Fund; 4) Adoption of a Resolution for the Final Naming Recognition for the JMZ; and 5) Approve a License Agreement With Stanford University for Research Space at the JMZ From: City Manager Lead Department: Community Services Recommendation Staff recommends that City Council take the following actions: 1. Approve a professional services agreement (C21180078) with Blue Rhino Studio, Inc. in the amount of $214,706 for the fabrication of dinosaur exhibits for the Junior Museum & Zoo; 2. Accept a $14,325 Christopher & Dana Reeve Foundation Grant for installation of adult changing tables at the Junior Museum & Zoo; 3. Amend the Fiscal Year 2021 Budget Appropriation for the Capital Improvement Fund , by a 2/3 vote, by: a. Increasing the revenue estimate for grants by $14,325; and b. Increasing the Junior Museum and Zoo Renovation Capital Improvement Project (AC- 18001) expense appropriation by $14,325; 4. Adopt a resolution to approve the donor recognitions for spaces and exhibits at the new facility; and 5. Approve a License Agreement between the City of Palo Alto and Leland Stanford Junior University for use of space at the Junior Museum and Zoo to conduct research. Background Founded in 1934, the Palo Alto Junior Museum & Zoo (JMZ) is dedicated to enriching the lives of children, ages 0 to 11, through hands-on exploration of the world. Specifically, the mission is City of Palo Alto Page 2 to engage a child’s curiosity for science and nature. This mission is furthered through a variety of exhibits, a diverse community of live animals, and educational programs for children, families and schools. The JMZ’s permanent location and facility was established in 1941, when the JMZ building was built, and in 1969, when the zoo was added. In 2015, the Friends of the Palo Alto Junior Museum and Zoo (Friends) launched the JMZ Initiative – a $25 million campaign to rebuild the outdated JMZ facility in recognition that the existing structures were not adequately sized nor designed to 1) accommodate the JMZ’s vibrant exhibits, expanded educational programs, current accessibility, and seismic code requirements, and 2) to meet best-practices in modern animal care and collection management. By January 2017, the Friends successfully met this campaign goal, thanks to a $15 million matching gift from the Peery Family and $10 million in other private donations from local donors. These donations have enabled the City and the Friends to build a new JMZ, which will improve the visitor experience by combining experiential exhibits with an expanded and optimized space to make science programming scalable and able to meet the increased needs of future generations. The JMZ has served families for more than 80 years and the new facility will ensure the same exceptional quality of early science education for children for many years to come. The JMZ construction project began in the summer of 2018 and is expected to conclude this fall. Details of the rebuilding process can be found in Council Memo 8851 from February 5, 2018 and Council Memo 9245 from May 29, 2018. The rebuilt JMZ will open under a new operating model described in detail in Staff Report 11093 and updated in Staff Report 11222. The new operating model was developed to ensure a safe and enjoyable experience for users of the new facility, to meet accreditation standards set by the Association of Zoos and Aquariums and the American Alliance of Museums, and to increase cost recovery by collecting an admission fee. Staff continue to evaluate the appropriate fee levels and plan to bring recommended adjustments to Finance Committee spring 2021. The JMZ is currently expected to reopen in late 2021 as a state-of-the-art museum and zoo built with a focus on inclusion, accessibility and the highest standards in animal care. In 2022, the JMZ will also open a permanent exhibit about the dinosaurs that lived in California. It will include live cretaceous-era plants, turtles, geologic specimens, a fossil dig, and life-size models of several types of dinosaurs from California. Council accepted a federa l grant and corresponding budget amendment to appropriate funding for the CA Dinosaur Garden on September 14, 2020 (Staff Report 11558). Discussion There are several recommended actions for City Council that are related to reopening the JMZ. The actions are explained in detail in the discussion below. City of Palo Alto Page 3 Contract with Blue Rhino Studios for Fabrication of Dinosaur Exhibit The City of Palo Alto was awarded $250,000 in matching gr ant funds from the Institute of Museum and Library Services (IMLS) Museums of America program earlier this year. The grant will support the California Dinosaur Garden, a permanent exhibition project, which will promote science learning and an inclusive environment for children ages 3-11, including children with cognitive and physical disabilities, and their caregivers. This project will leverage JMZ’s expertise in providing families with engaging, age-appropriate STEM experiences and our deep institutional commitment to inclusion for people of all abilities. The Blue Rhino Studios contract for $214,706 (Attachment A) is to fabricate the large dinosaurs exhibit, while the remaining grant funds will be used for staff time and contractors to support the smaller dinosaur exhibits. Summary of Bid Process On September 17, 2020, a Request for Proposal (RFP) for Dinosaurs Fabrication Project was posted on the City’s eProcurement system and notices were sent to prospective vendors. Seven responsive proposals were received on October 19, 2020. Blue Rhino Studio, Inc.’s proposal scored the highest. The following table summarizes the results of the RFP solicitation. Summary of Bid Process Proposal Description Dinosaurs Fabrication Project Number of Vendors Notified 168 Number of Prepositive Proposers 29 Number of Proposal Packages Downloaded 28 Total Days to Respond to Proposal 33 days Pre-Proposal Meeting September 28, 2020 Number of Responsive Proposals Received 7 Proposal Estimated Price Range $116,224 to $761,800 Staff evaluated the seven responsive proposals and based on that review, recommend that City award a contract to Blue Rhino Studio, Inc. in accordance with the RFP procedures. Blue Rhino Studio, Inc. was not the lowest estimated bid, it was the second lowest out of seven, however price was only one of multiple factors evaluated. Staff rated Blue Rhino Studio, Inc. based on: • Quality of the proposal, performance, and effectiveness of the services to be provided . • Contractor’s experience, including the experience of staff to be assigned to the project, with engagements of similar scope and complexity. • Cost to the City • Contractor’s ability to perform the contract within the time specified . • Contractor’s prior record of performance with city or others. • Contractor’s ability to provide future maintenance, repairs, pats and/or services. • Contractor’s compliance with applicable laws, regulations, policies (including city council policies), guidelines and orders governing prior or existing contracts performed by the contractor. City of Palo Alto Page 4 Acceptance of Christopher & Dana Reeve Foundation Grant The Christopher & Dana Reeve Foundation has awarded the JMZ a Quality of Life Grant for $14,325. The funds will enable the JMZ to better serve children and adults with paralysis an d other disabilities, as well as their parents, family members and caregivers by installing two adult-size, motorized changing tables in two existing restrooms. This equipment will allow parents and caregivers to assist their child or adult with toileting needs in a comfortable and healthy manner. These changing tables provide inclusion to families who would not be able to visit the JMZ without an appropriate and safe way to tend to a larger child’s or adult’s changing and care requirements. The grant funds support the JMZ’s accessibility initiative for inclusion of people with disabilities in the new facility, and the recommendation for the changing tables came from our families who have children with disabilities and our Accessibility Advisory Committee members. The changing tables put the JMZ at the forefront of best practices in accessibility. The budget includes the purchase of two adult-size, motorized changing tables, electrical outlets, and installation. The project will be completed by May 31, 2021. Corresponding budgetary actions are recommended in recognition of these funds and the expected work. Naming Recognition The Friends of the Junior Museum and Zoo were able to raise funds, in part, by offering name recognition for significant donations. The naming recognition process has followed the City’s policy on naming city-owned land and facilities as outlined in Policy and Procedures 1-15 (Naming City-Owned Land and Facilities). A naming recognition plan was approved by City Council in 2017 in Staff Report 7810. Donor recognitions and examples of what the recognitions will look like are included in the attached resolution to this report (See Attachment B). The Peery Family, who funded more than half of the campaign , will be prominently recognized within and adjacent to the central donor board located at the entrance. Staff recommends adopting this resolution to approve the facility naming plan and names, which meets the City policy’s criteria for facility naming as it is in recognition of a significant monetary contribution. City staff and the Friends propose to offer naming rights for spa ces at the JMZ for donors who have contributed $100,000 or more and for which all pledged gifts have been received. The Final Naming Recognition Report is in the table below and additional details are found in the Attachment B. City of Palo Alto Page 5 Final Naming Recognition Report Site Recognition Adjacent to the Central Donor Board The Peery Family Science Education Wing A gift of Carmen M. Christensen (1913 - 2010) Exhibit Hall An anonymous gift dedicated to all future scientists, explorers and inventors Ball Machine A gift of the Hahn-Harik Family in loving memory of our grandmother, Nazira Harik Issa Baby’s Space A gift of the John & Marcia Goldman Foundation Tortoise Trail A gift of Marissa Mayer & Zachary Bogue / Macallister, Sylvana & Marielle Animal Ambassador Center A gift of The Thelma Doelger Trust for Animals The Dig A gift of Kelly and Clay Bavor Collections Corner A gift of the Cheung Family Rainbow Bridge A gift of the Morgan Family Foundation Dawn Redwood Courtyard A gift of the Rotary Club of Palo Alto / Chartered 1922 / Logo Animal Sculptures A gift of Meredith and Nicholas Tan Geodesic Dome A gift of the Ludwick Family There are additional naming recognition opportunities still available in a variety of spaces throughout the facility, as described in the memo in Attachment B. If additional significant donations are made and donors would like naming recognition, staff will bring this forward to City Council. Stanford License Agreement For more than six years, the JMZ has developed a relationship w ith Stanford researchers in the Psychology Department for the mutual benefit of JMZ staff, visitors, and Stanford researchers. With the new facility opening, staff recommend enhancing this relationship with a license agreement to allow Stanford researchers to work during museum open hours within the new facility. The agreement would allow researchers to utilize a small room off the exhibit hall as a space to conduct research on child behavior and development and to solicit visitors to volunteer to participate. Research will not be conducted on visitors without their consent. JMZ visitors and staff will also benefit from this agreement as it will allow researchers to provide educational opportunities for JMZ staff related to child behavior and development and to engage the community in research and research findings about the science of early learning and development. As a mutual benefit, the agreement does not stipulate any fee for use of approximately 124 sq. feet of space, however, does ensure the Cit y retains full discretion to manage the premises. The entire license agreement is attached to this report as Attachment C. City of Palo Alto Page 6 Policy Implications The recommended actions outlined in this report advance many important policy objectives related to the City Comprehensive Plan Policy Goal C-1: Deliver community services effectively and efficiently. These include: • Policy C-1.4 Promote City parks, open spaces, recreational facilities, libraries, classes and cultural activities for community members recognizing that these facilities and services build and strengthen community. • Policy C-1.16 Provide arts, science and recreational activities that foster healthy children, youth and teen development. • Policy C-1.20 Leverage available funding to support the development of, and improved access to, programs that address all types of developmental disabilities, including physical, sensory, cognitive or social/emotional needs. Resource Impact Blue Rhino Contract - The large dinosaur models fabricated in this contract are part of a larger exhibition that includes smaller dinosaur and reptile models, graphics, and a fossil dig activity area. The contract will be funded by the IMLS grant of $250,000 and the matching City contribution required by the IMLS grant is comprised of staff salaries and benefits and contractor expenses already budgeted. Funding is available in the FY 2021 Adopted Capital Budget of the JMZ Renovation Capital Improvement Project (CIP) (AC-18001). Ongoing maintenance of the dinosaur garden exhibit is estimated to be $500 annually and will be absorbed by the JMZ’s operating budget. Christopher and Dana Reeve Foundation Grant - The grant funds the purchase of two adult-size motorized changing tables, electrical outlets, and installation. Ongoing maintenance of the changing tables beyond the three-year warranty is estimated to be $100 annually and will be absorbed by the JMZ’s operating budget. There is no further resource impact associated with the Christopher and Dana Reeve Foundation Grant. Stakeholder Engagement JMZ staff conducted surveys and small focus groups in 2019 to better understand JMZ visitors’ knowledge and interest in California during the dinosaur age. Most visitors felt that they knew very little about California in the dinosaur age despite much enthusiasm about dinosaurs from the children in their families. The California Dinosaur Garden exhibit was designed with results from these surveys in mind. JMZ staff consulted with families who have children with disabilities and the JMZ’s Accessibi lity Advisory Committee during design to ensure that people of all abilities can visit and enjoy the new museum and zoo. Periodic surveys conducted by the staff of the JMZ about attendees’ experiences indicate that City of Palo Alto Page 7 visitors value the research conducted by Stanford and enjoy the opportunity to participate. Environmental Review The new JMZ has been evaluated as a project under CEQA. In December 2017, the City Council adopted Resolution 9727 which approved a Mitigated Negative Declaration and Mitigation Monitoring and Reporting Program for the new Junior Museum and Zoo. Attachments: • Attachment A: C21180078 Blue Rhino Contract • Attachment B: Resolution Approving Donor Recognitions at the New Junior Museum and Zoo • Attachment C: JMZ-Stanford License Agreement City of Palo Alto General Services Agreement 1 Rev. March 29, 2018 CITY OF PALO ALTO CONTRACT NO. C21180078 GENERAL SERVICES AGREEMENT THIS AGREEMENT made and entered into on , by and between the CITY OF PALO ALTO, a California chartered municipal corporation (“CITY”), and BLUE RHINO STUDIO, INC., a Minnesota corporation, located at 3277 Sun Drive, Eagan, MN 55121, Telephone Number: (651) 287-0900 (“CONTRACTOR”). In consideration of their mutual covenants, the parties hereto agree as follows: 1. SERVICES. CONTRACTOR shall provide or furnish the services (the “Services”) described in the Scope of Services, attached at Exhibit A. 2. EXHIBITS. The following exhibits are attached to and made a part of this Agreement: “A” - Scope of Services “A-1” – Engineering Drawings and Photos of Models “B” - Schedule of Performance “C” – Schedule of Fees “D” - Insurance Requirements CONTRACT IS NOT COMPLETE UNLESS ALL INDICATED EXHIBITS ARE ATTACHED. 3. TERM. The term of this Agreement is from Jan 1, 2021 to June 30, 2023 inclusive, subject to the provisions of Sections R and W of the General Terms and Conditions. 4. SCHEDULE OF PERFORMANCE. CONTRACTOR shall complete the Services within the term of this Agreement in a reasonably prompt and timely manner based upon the circumstances and direction communicated to CONTRACTOR, and if applicable, in accordance with the schedule set forth in the Schedule of Performance, attached at Exhibit B. Time is of the essence in this Agreement. 5. COMPENSATION FOR ORIGINAL TERM. CITY shall pay and CONTRACTOR agrees to accept as not-to-exceed compensation for the full performance of the Services and reimbursable expenses, if any: The total maximum lump sum compensation of dollars ($ ); OR DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 2 Rev. March 29, 2018 The sum of dollars ($ ) per hour, not to exceed a total maximum compensation amount of dollars ($ ); OR A sum calculated in accordance with the fee schedule set forth at Exhibit C, not to exceed a total maximum compensation amount of Two Hundred Fourteen Thousand Seven Hundred and Six dollars ($214,706.00). CONTRACTOR agrees that it can perform the Services for an amount not to exceed the total maximum compensation set forth above. Any hours worked or services performed by CONTRACTOR for which payment would result in a total exceeding the maximum amount of compensation set forth above for performance of the Services shall be at no cost to CITY. CITY has set aside the sum of dollars ($ ) for Additional Services. CONTRACTOR shall provide Additional Services only by advanced, written authorization from the City Manager or designee. CONTRACTOR, at the CITY’s request, shall submit a detailed written proposal including a description of the scope of services, schedule, level of effort, and CONTRACTOR’s proposed maximum compensation, including reimbursable expense, for such services. Compensation shall be based on the hourly rates set forth above or in Exhibit C (whichever is applicable), or if such rates are not applicable, a negotiated lump sum. CITY shall not authorize and CONTRACTOR shall not perform any Additional Services for which payment would exceed the amount set forth above for Additional Services. Payment for Additional Services is subject to all requirements and restrictions in this Agreement. 6. COMPENSATION DURING ADDITIONAL TERMS. CONTRACTOR’S compensation rates for each additional term shall be the same as the original term; OR CONTRACTOR’s compensation rates shall be adjusted effective on the commencement of each Additional Term. The lump sum compensation amount, hourly rates, or fees, whichever is applicable as set forth in section 5 above, shall be adjusted by a percentage equal to the change in the Consumer Price Index for Urban Wage Earners and Clerical Workers for the San Francisco-Oakland- San Jose area, published by the United States Department of Labor Statistics (CPI) which is published most immediately preceding the commencement of the applicable Additional Term, which shall be compared with the CPI published most immediately preceding the commencement date of the then expiring term. Notwithstanding the foregoing, in no event shall CONTRACTOR’s compensation rates be DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 3 Rev. March 29, 2018 increased by an amount exceeding five percent of the rates effective during the immediately preceding term. Any adjustment to CONTRACTOR’s compensation rates shall be reflected in a written amendment to this Agreement. 7. CLAIMS PROCEDURE FOR “9204 PUBLIC WORKS PROJECTS”. For purposes of this Section 7, a “9204 Public Works Project” means the erection, construction, alteration, repair, or improvement of any public structure, building, road, or other public improvement of any kind. Public Contract Code Section 9204 mandates certain claims procedures for Public Works Projects, which are set forth in “Appendix __ Claims for Public Contract Code Section 9204 Public Works Projects”. This project is a 9204 Public Works Project and is required to comply with the claims procedures set forth in Appendix __, attached hereto and incorporated herein. OR This project is not a 9204 Public Works Project. 8. INVOICING. Send all invoices to CITY, Attention: Project Manager. The Project Manager is: Tina Keegan, Dept.: Community Services Department, Telephone:(650) 329-2624. Invoices shall be submitted in arrears for Services performed. Invoices shall not be submitted more frequently than monthly. Invoices shall provide a detailed statement of Services performed during the invoice period and are subject to verification by CITY. CITY shall pay the undisputed amount of invoices within 30 days of receipt. GENERAL TERMS AND CONDITIONS A. ACCEPTANCE. CONTRACTOR accepts and agrees to all terms and conditions of this Agreement. This Agreement includes and is limited to the terms and conditions set forth in sections 1 through 8 above, these general terms and conditions and the attached exhibits. B. QUALIFICATIONS. CONTRACTOR represents and warrants that it has the expertise and qualifications to complete the services described in Section 1 of this Agreement, entitled “SERVICES,” and that every individual charged with the performance of the services under this Agreement has sufficient skill and experience and is duly licensed or certified, to the extent such licensing or certification is required by law, to perform the Services. CITY expressly relies on DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 4 Rev. March 29, 2018 CONTRACTOR’s representations regarding its skills, knowledge, and certifications. CONTRACTOR shall perform all work in accordance with generally accepted business practices and performance standards of the industry, including all federal, state, and local operation and safety regulations. C. INDEPENDENT CONTRACTOR. It is understood and agreed that in the performance of this Agreement, CONTRACTOR and any person employed by CONTRACTOR shall at all times be considered an independent CONTRACTOR and not an agent or employee of CITY. CONTRACTOR shall be responsible for employing or engaging all persons necessary to complete the work required under this Agreement. D. SUBCONTRACTORS. CONTRACTOR may not use subcontractors to perform any Services under this Agreement unless CONTRACTOR obtains prior written consent of CITY. CONTRACTOR shall be solely responsible for directing the work of approved subcontractors and for any compensation due to subcontractors. E. TAXES AND CHARGES. CONTRACTOR shall be responsible for payment of all taxes, fees, contributions or charges applicable to the conduct of CONTRACTOR’s business. F. COMPLIANCE WITH LAWS. CONTRACTOR shall in the performance of the Services comply with all applicable federal, state and local laws, ordinances, regulations, and orders. G. PALO ALTO MINIMUM WAGE ORDINANCE. CONTRACTOR shall comply with all requirements of the Palo Alto Municipal Code Chapter 4.62 (Citywide Minimum Wage), as it may be amended from time to time. In particular, for any employee otherwise entitled to the State minimum wage, who performs at least two (2) hours of work in a calendar week within the geographic boundaries of the City, CONTRACTOR shall pay such employees no less than the minimum wage set forth in Palo Alto Municipal Code section 4.62.030 for each hour worked within the geographic boundaries of the City of Palo Alto. In addition, CONTRACTOR shall post notices regarding the Palo Alto Minimum Wage Ordinance in accordance with Palo Alto Municipal Code section 4.62.060. H. DAMAGE TO PUBLIC OR PRIVATE PROPERTY. CONTRACTOR shall, at its sole expense, repair in kind, or as the City Manager or designee shall direct, any damage to public or private property that occurs in connection with CONTRACTOR’s performance of the Services. CITY may decline to approve and may withhold payment in whole or in part to such extent as may be necessary to protect CITY from loss because of defective work not remedied or other damage to the CITY occurring in connection with CONTRACTOR’s performance of the DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 5 Rev. March 29, 2018 Services. CITY shall submit written documentation in support of such withholding upon CONTRACTOR’s request. When the grounds described above are removed, payment shall be made for amounts withheld because of them. I. WARRANTIES. CONTRACTOR expressly warrants that all services provided under this Agreement shall be performed in a professional and workmanlike manner in accordance with generally accepted business practices and performance standards of the industry and the requirements of this Agreement. CONTRACTOR expressly warrants that all materials, goods and equipment provided by CONTRACTOR under this Agreement shall be fit for the particular purpose intended, shall be free from defects, and shall conform to the requirements of this Agreement. CONTRACTOR agrees to promptly replace or correct any material or service not in compliance with these warranties, including incomplete, inaccurate, or defective material or service, at no further cost to CITY. The warranties set forth in this section shall be in effect for a period of one year from completion of the Services and shall survive the completion of the Services or termination of this Agreement. J. MONITORING OF SERVICES. CITY may monitor the Services performed under this Agreement to determine whether CONTRACTOR’s work is completed in a satisfactory manner and complies with the provisions of this Agreement. K. CITY’S PROPERTY. Any reports, information, data or other material (including copyright interests) developed, collected, assembled, prepared, or caused to be prepared under this Agreement will become the property of CITY without restriction or limitation upon their use and will not be made available to any individual or organization by CONTRACTOR or its subcontractors, if any, without the prior written approval of the City Manager. L. AUDITS. CONTRACTOR agrees to permit CITY and its authorized representatives to audit, at any reasonable time during the term of this Agreement and for three (3) years from the date of final payment, CONTRACTOR’s records pertaining to matters covered by this Agreement. CONTRACTOR agrees to maintain accurate books and records in accordance with generally accepted accounting principles for at least three (3) following the terms of this Agreement. M. NO IMPLIED WAIVER. No payment, partial payment, acceptance, or partial acceptance by CITY shall operate as a waiver on the part of CITY of any of its rights under this Agreement. N. INSURANCE. CONTRACTOR, at its sole cost, shall purchase and maintain in full force during the term of this Agreement, the insurance coverage described at Exhibit D. Insurance must be provided by companies with a Best’s Key Rating of A- DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 6 Rev. March 29, 2018 :VII or higher and which are otherwise acceptable to CITY’s Risk Manager. The Risk Manager must approve deductibles and self-insured retentions. In addition, all policies, endorsements, certificates and/or binders are subject to approval by the Risk Manager as to form and content. CONTRACTOR shall obtain a policy endorsement naming the City of Palo Alto as an additional insured under any general liability or automobile policy. CONTRACTOR shall obtain an endorsement stating that the insurance is primary coverage and will not be canceled or materially reduced in coverage or limits until after providing 30 days prior written notice of the cancellation or modification to the Risk Manager. CONTRACTOR shall provide certificates of such policies or other evidence of coverage satisfactory to the Risk Manager, together with the required endorsements and evidence of payment of premiums, to CITY concurrently with the execution of this Agreement and shall throughout the term of this Agreement provide current certificates evidencing the required insurance coverages and endorsements to the Risk Manager. CONTRACTOR shall include all subcontractors as insured under its policies or shall obtain and provide to CITY separate certificates and endorsements for each subcontractor that meet all the requirements of this section. The procuring of such required policies of insurance shall not operate to limit CONTRACTOR’s liability or obligation to indemnify CITY under this Agreement. O. HOLD HARMLESS. To the fullest extent permitted by law and without limitation by the provisions of section N relating to insurance, CONTRACTOR shall indemnify, defend and hold harmless CITY, its Council members, officers, employees and agents from and against any and all demands, claims, injuries, losses, or liabilities of any nature, including death or injury to any person, property damage or any other loss and including without limitation all damages, penalties, fines and judgments, associated investigation and administrative expenses and defense costs, including, but not limited to reasonable attorney’s fees, courts costs and costs of alternative dispute resolution), arising out of, or resulting in any way from or in connection with the performance of this Agreement. CONTRACTOR’s obligations under this Section apply regardless of whether or not a liability is caused or contributed to by any negligent (passive or active) act or omission of CITY, except that CONTRACTOR shall not be obligated to indemnify for liability arising from the sole negligence or willful misconduct of CITY. The acceptance of the Services by CITY shall not operate as a waiver of the right of indemnification. The provisions of this Section survive the completion of the Services or termination of this Agreement. P. NON-DISCRIMINATION. As set forth in Palo Alto Municipal Code section 2.30.510, CONTRACTOR certifies that in the performance of this Agreement, it shall not discriminate in the employment of any person because of the race, skin color, gender, age, religion, disability, national origin, ancestry, sexual orientation, housing status, marital status, familial status, weight or height of such person. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 7 Rev. March 29, 2018 CONTRACTOR acknowledges that it has read and understands the provisions of Section 2.30.510 of the Palo Alto Municipal Code relating to Nondiscrimination Requirements and the penalties for violation thereof, and agrees to meet all requirements of Section 2.30.510 pertaining to nondiscrimination in employment. Q. WORKERS' COMPENSATION. CONTRACTOR, by executing this Agreement, certifies that it is aware of the provisions of the Labor Code of the State of Califor- nia which require every employer to be insured against liability for workers' compensation or to undertake self-insurance in accordance with the provisions of that Code, and certifies that it will comply with such provisions, as applicable, before commencing and during the performance of the Services. R. TERMINATION. The City Manager may terminate this Agreement without cause by giving ten (10) days’ prior written notice thereof to CONTRACTOR. If CONTRACTOR fails to perform any of its material obligations under this Agreement, in addition to all other remedies provided by law, the City Manager may terminate this Agreement immediately upon written notice of termination. Upon receipt of such notice of termination, CONTRACTOR shall immediately discontinue performance. CITY shall pay CONTRACTOR for services satisfactorily performed up to the effective date of termination. If the termination is for cause, CITY may deduct from such payment the amount of actual damage, if any, sustained by CITY due to CONTRACTOR’s failure to perform its material obligations under this Agreement. Upon termination, CONTRACTOR shall immediately deliver to the City Manager any and all copies of studies, sketches, drawings, computations, and other material or products, whether or not completed, prepared by CONTRACTOR or given to CONTRACTOR, in connection with this Agreement. Such materials shall become the property of CITY. S. ASSIGNMENTS/CHANGES. This Agreement binds the parties and their successors and assigns to all covenants of this Agreement. This Agreement shall not be assigned or transferred without the prior written consent of CITY. No amendments, changes or variations of any kind are authorized without the written consent of CITY. T. CONFLICT OF INTEREST. In accepting this Agreement, CONTRACTOR covenants that it presently has no interest, and will not acquire any interest, direct or indirect, financial or otherwise, which would conflict in any manner or degree with the performance of this Agreement. CONTRACTOR further covenants that, in the performance of this Agreement, it will not employ any person having such an interest. CONTRACTOR certifies that no CITY officer, employee, or authorized representative has any financial interest in the business of CONTRACTOR and that no person associated with CONTRACTOR has any interest, direct or indirect, which DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 8 Rev. March 29, 2018 could conflict with the faithful performance of this Agreement. CONTRACTOR agrees to advise CITY if any conflict arises. U. GOVERNING LAW. This Agreement shall be governed and interpreted by the laws of the State of California. V. ENTIRE AGREEMENT. This Agreement, including all exhibits, represents the entire agreement between the parties with respect to the services that may be the subject of this Agreement. Any variance in the exhibits does not affect the validity of the Agreement and the Agreement itself controls over any conflicting provisions in the exhibits. This Agreement supersedes all prior agreements, representations, statements, negotiations and undertakings whether oral or written. W. NON-APPROPRIATION. This Agreement is subject to the fiscal provisions of the Charter of the City of Palo Alto and the Palo Alto Municipal Code. This Agreement will terminate without any penalty (a) at the end of any fiscal year in the event that funds are not appropriated for the following fiscal year, or (b) at any time within a fiscal year in the event that funds are only appropriated for a portion of the fiscal year and funds for this Agreement are no longer available. This Section shall take precedence in the event of a conflict with any other covenant, term, condition, or provision of this Agreement. X. ENVIRONMENTALLY PREFERRED PURCHASING AND ZERO WASTE REQUIREMENTS. CONTRACTOR shall comply with CITY’s Environmentally Preferred Purchasing policies which are available at CITY’s Purchasing Division, which are incorporated by reference and may be amended from time to time. CONTRACTOR shall comply with waste reduction, reuse, recycling and disposal requirements of CITY’s Zero Waste Program. Zero Waste best practices include first minimizing and reducing waste; second, reusing waste and third, recycling or composting waste. In particular, CONTRACTOR shall comply with the following zero waste requirements: • All printed materials provided by CONTRACTOR to CITY generated from a personal computer and printer including but not limited to, proposals, quotes, invoices, reports, and public education materials, shall be double- sided and printed on a minimum of 30% or greater post-consumer content paper, unless otherwise approved by CITY’s Project Manager. Any submitted materials printed by a professional printing company shall be a minimum of 30% or greater post-consumer material and printed with vegetable based inks. • Goods purchased by Contractor on behalf of CITY shall be purchased in accordance with CITY’s Environmental Purchasing Policy including, but not limited to, Extended Producer Responsibility requirements for products and packaging. A copy of this policy is on file at the Purchasing Division’s DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 9 Rev. March 29, 2018 office. • Reusable/returnable pallets shall be taken back by CONTRCATOR, at no additional cost to CITY, for reuse or recycling. CONTRACTOR shall provide documentation from the facility accepting the pallets to verify that pallets are not being disposed. Y. AUTHORITY. The individual(s) executing this Agreement on behalf of the parties represent and warrant that they have the legal capacity and authority to do so on behalf of their respective legal entities. Z. PREVAILING WAGES This Project is not subject to prevailing wages. CONTRACTOR is not required to pay prevailing wages in the performance and implementation of the Project in accordance with SB 7, if the Agreement is not a public works contract, if Agreement does not include a public works construction project of more than $25,000, or the Agreement does not include a public works alteration, demolition, repair, or maintenance (collectively, ‘improvement’) project of more than $15,000. OR Contractor is required to pay general prevailing wages as defined in Subchapter 3, Title 8 of the California Code of Regulations and Section 16000 et seq. and Section 1773.1 of the California Labor Code. Pursuant to the provisions of Section 1773 of the Labor Code of the State of California, the City Council has obtained the general prevailing rate of per diem wages and the general rate for holiday and overtime work in this locality for each craft, classification, or type of worker needed to execute the Agreement for this Project from the Director of the Department of Industrial Relations (“DIR”). Copies of these rates may be obtained at the Purchasing Division’s office of the City of Palo Alto. Contractor shall provide a copy of prevailing wage rates to any staff or subcontractor hired, and shall pay the adopted prevailing wage rates as a minimum. Contractor shall comply with the provisions of all sections, including, but not limited to, Sections 1775, 1776, 1777.5, 1782, 1810, and 1813, of the Labor Code pertaining to prevailing wages. AA. DIR REGISTRATION. In regard to any public work construction, alteration, demolition, repair or maintenance work, CITY will not accept a bid proposal from or enter into this Agreement with CONTRACTOR without proof that CONTRACTOR and its listed subcontractors are registered with the California Department of Industrial Relations (“DIR”) to perform public work, subject to limited exceptions. City requires CONTRACTOR and its listed subcontractors to comply with the requirements of SB 854. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 10 Rev. March 29, 2018 CITY provides notice to CONTRACTOR of the requirements of California Labor Code section 1771.1(a), which reads: “A contractor or subcontractor shall not be qualified to bid on, be listed in a bid proposal, subject to the requirements of Section 4104 of the Public Contract Code, or engage in the performance of any contract for public work, as defined in this chapter, unless currently registered and qualified to perform public work pursuant to Section 1725.5. It is not a violation of this section for an unregistered contractor to submit a bid that is authorized by Section 7029.1 of the Business and Professions Code or Section 10164 or 20103.5 of the Public Contract Code, provided the contractor is registered to perform public work pursuant to Section 1725.5 at the time the Agreement is awarded.” CITY gives notice to CONTRACTOR and its listed subcontractors that CONTRACTOR is required to post all job site notices prescribed by law or regulation and CONTRACTOR is subject to SB 854-compliance monitoring and enforcement by DIR. CITY requires CONTRACTOR and its listed subcontractors to comply with the requirements of Labor Code section 1776, including: Keep accurate payroll records, showing the name, address, social security number, work classification, straight time and overtime hours worked each day and week, and the actual per diem wages paid to each journeyman, apprentice, worker, or other employee employed by, respectively, CONTRACTOR and its listed subcontractors, in connection with the Project. The payroll records shall be verified as true and correct and shall be certified and made available for inspection at all reasonable hours at the principal office of CONTRACTOR and its listed subcontractors, respectively. At the request of CITY, acting by its project manager, CONTRACTOR and its listed subcontractors shall make the certified payroll records available for inspection or furnished upon request to the project manager within ten (10) days of receipt of CITY’s request. [For state- and federally-funded projects] CITY requests CONTRACTOR and its listed subcontractors to submit the certified payroll records to the project manager at the end of each week during the Project. If the certified payroll records are not produced to the project manager within the 10-day period, then CONTRACTOR and its listed subcontractors shall be DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 11 Rev. March 29, 2018 subject to a penalty of one hundred dollars ($100.00) per calendar day, or portion thereof, for each worker, and CITY shall withhold the sum total of penalties from the progress payment(s) then due and payable to CONTRACTOR. Inform the project manager of the location of CONTRACTOR’s and its listed subcontractors’ payroll records (street address, city and county) at the commencement of the Project, and also provide notice to the project manager within five (5) business days of any change of location of those payroll records. BB. CONTRACT TERMS. All unchecked boxes do not apply to this Agreement. In the case of any conflict between the terms of this Agreement and the exhibits hereto or CONTRACTOR’s proposal (if any), the Agreement shall control. In the case of any conflict between the exhibits hereto and CONTRACTOR’s proposal, the exhibits shall control. IN WITNESS WHEREOF, the parties hereto have by their duly authorized representatives executed this Agreement on the date first above written. CITY OF PALO ALTO BLUE RHINO STUDIO, INC. ______________________________ By________________________________________ City Manager or Designee Name _____________________________________ Title_______________________________________ Approved as to form: ___________________________ City Attorney or Designee DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Tim Quady President Attachment A City of Palo Alto General Services Agreement 12 Rev. March 29, 2018 EXHIBIT A SCOPE OF SERVICES This project entails the artistic creation of three life-size, scientifically realistic sculptures. Contract responsibilities include design, communication with JMZ’s scientific advisors, fabrication of full-size sculptures, shipment and onsite oversight during installation. The JMZ will be responsible for hiring a crane (if required) and/or installation crew. The three sculptures include: 1. Aletopelta coombsi (a type of ankylosaur, approximately 17’ long): This is an outdoor sculpture and will be climbable by visitors and should therefore hold up to the rigors of repeated touch. 2. Augustynolophus morrisi (approximately 30’ long): This is an outdoor sculpture and will be not be touchable by visitors. It will be located in a fenced area. 3. Pteranodon (in flight, 18’ wingspan): The sculpture will be located inside the museum and hung from architectural steel beams via steel cable. It should have structural eyebolts or other hardware to connect cables to. Contractor is responsible for cable spec to ensure structural capability. It will be non-touchable and hung at a height that is out-of-reach by visitors. It must be completed and delivered by Feb. 2021 to assist in marketing and fundraising efforts. Fabrication methods and materials should meet these specifications: • Contractor must adhere to the previously approved models, structurally engineered designs, and stamped engineering drawings that were completed in an earlier contract as attached in Exhibit A- 1 to this Agreement. Concrete footings based on the stamped drawings have already been installed during building construction by the general contractor. The two large dinosaur sculptures (Aletopelta and Augustynolophus) must structurally attach to these existing footings. • Exterior should be durable, exterior grade fiberglass, painted in a scientifically accurate manner with detailed, scientifically accurate body textures. The JMZ has scientific advisors for the contractor to utilize and approve in process sculptures. The Contractor will manage sculpture fabrication in accordance with the terms and conditions of the City contract. Services shall also include but are not limited to the following: • Participate in meetings required to coordinate the work. Submit timely requests for clarification, specifications, and scientific details to City’s Project Manager. Communicate clearly and seek timely approvals of sculptures. • Be onsite to manage proper installation of sculptures to existing footings to meet structural engineering drawings. JMZ will secure local contracts and crane (if necessary) for installation as well as manage those contractors. • Prepare and maintain a schedule for regular updates to City’s Project Manager. Conduct interim sculpture reviews via email and photographs with City’s Project Manager as required. • Ensure that punch list items are completed promptly, and that incomplete or deficient work is completed/repaired/replaced at no additional cost to the City. • Provide documentation to the City for maintenance requirements, including a maintenance schedule and any necessary parts, material or touch-up paint specs. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 13 Rev. March 29, 2018 EXHIBIT A-1 ENGINEERING DRAWINGS AND PHOTOS OF MODELS The following engineering drawings and photos of models on the following pages are: 1. Aletopelta photos DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 14 Rev. March 29, 2018 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 15 Rev. March 29, 2018 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 16 Rev. March 29, 2018 2. Augustynolophus photos DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 17 Rev. March 29, 2018 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 18 Rev. March 29, 2018 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 19 Rev. March 29, 2018 3. Pteranodon photos DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 20 Rev. March 29, 2018 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A SCALE: DWN BY: CHK'D BY: DWG. REF.:ISSUE: REVISIONS: PROJECT NO.: PROJECT NAME: 154.003-19 N.T.S. D.R.O. R.H May 2, 2019 S;-3HADROSAUR FOOTING DETAIL Orie Engineering 2 Structural and Bridge EngineersORIE2 STRUCTURAL BRIDGE 950 MiraPar RRaG, SXiWe 310 San DiegR, CA 9212 Fa[: 5 5-0911 PALO ALTO DINOS CA DINOSAUR GARDEN D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A SCALE: DWN BY: CHK'D BY: DWG. REF.:ISSUE: REVISIONS: PROJECT NO.: PROJECT NAME: 154.003-19 N.T.S. D.R.O. R.H May 2, 2019 S;-1STRUCTURAL NOTES Orie Engineering 2 Structural and Bridge EngineersORIE2 STRUCTURAL BRIDGE 950 MiraPar RRaG, SXiWe 310 San DiegR, CA 9212 Fa[: 5 5-0911 PALO ALTO DINOS CA DINOSAUR GARDEN D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A SCALE: DWN BY: CHK'D BY: DWG. REF.:ISSUE: REVISIONS: PROJECT NO.: PROJECT NAME: 154.003-19 N.T.S. D.R.O. R.H. May 2, 2019 S;-2ALETOPELTA FOOTING DETAIL Orie Engineering 2 Structural and Bridge EngineersORIE2 STRUCTURAL BRIDGE 950 MiraPar RRaG, SXiWe 310 San DiegR, CA 9212 Fa[: 5 5-0911 PALO ALTO DINOS CA DINOSAUR GARDEN D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: ALETOPELTA ELEVATION Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Material: STEEL ARMATURE, FOAM, FIBERGLASS, EPOXY 142 15/16" 54 7/16" STAN IS 72” (6 feet) TALL D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: ALETOPELTA ARMATURE ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Material: COLD ROLLED/P&O STEEL. 16” DIAMETER x 1/2” THICK P&O PLATE STEEL x(3) (TYPICAL) PASSENGER SIDE ARMATURE 1/2” LASER CUT P&O 7.61 SQ FT. 3” x 3” x 1/8” ERW (x3) TAIL ARMATURE 1/2” LASER CUT P&O 3.69 SQ FT. DRIVER SIDE ARMATURE 1/2” LASER CUT P&O 7.09 SQ FT. PASSENGER SIDE LEG BRACE 1/2” x 1.25” CR STEEL DRIVER SIDE FRONT LEG BRACE 1/2” x 1.5” CR STEEL DRIVER SIDE REAR LEG BRACE 1/2” x 1.5” CR STEEL D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: ALETOPELTA ARMATURE ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Material: COLD ROLLED/P&O STEEL. 16” DIAMETER x 1/2” THICK P&O PLATE STEEL x(3) (TYPICAL) PASSENGER SIDE ARMATURE 1/2” LASER CUT P&O 7.61 SQ FT. 3” x 3” x 1/8” ERW (x3) TAIL ARMATURE 1/2” LASER CUT P&O 3.69 SQ FT. DRIVER SIDE ARMATURE 1/2” LASER CUT P&O 7.09 SQ FT. PASSENGER SIDE LEG BRACE 1/2” x 1.25” CR STEEL DRIVER SIDE FRONT LEG BRACE 1/2” x 1.5” CR STEEL DRIVER SIDE REAR LEG BRACE 1/2” x 1.5” CR STEEL ARMATURE WEIGHT CALCULATIONS PASSENGER SIDE ARMATURE - 7.61 SQ FT. 155.4 LBS DRIVER SIDE ARMATURE - 7.09 SQ FT. 144.8 LBS TAIL ARMATURE - 3.69 SQ FT. 75.3 LBS 3” x 1/8” ERW - 5.5 LIN FT. 26.1 LBS 16”D x 1/2” PLATES x(3) - 11.14 LBS EA. 33.4 LBS 435 LBS TOTAL D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: ALETOPELTA UNDERNEATH Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Material: STEEL ARMATURE, FOAM, FIBERGLASS, EPOXY 16 13/16"61 5/16" 44 9/16" 30 9/16" 25 1/4" 5 5/16" HILTI HIT-Z 1/2” x 6” ANCHOR RODS + HILTI HIT-HY 200 HYBRID MORTAR + D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: ALETOPELTA ANCHORING ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Material: STEEL ARMATURE, FOAM, FIBERGLASS, EPOXY 16” DIAMETER x 1/2” THICK P&O PLATE STEEL x(3) (TYPICAL) HILTI HIT-Z 1/2”DIA. x 6” x(9) TYP. + HILTI HY-200 HYBRID MORTAR D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR DIMMED ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL/2LB FOAM/FIBERGLASS/EPOXY 381 1/4" 149 1/16" 128 7/16" D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL/2LB FOAM/FIBERGLASS/EPOXY D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR ARMATURE ELEVATION V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL WEIGHT ESTIMATE PART/COLOR MATERIAL WEIGHT (in US LBS) TAIL JOINT 1/2” P&O 367 LBS PASSENGER REAR LEG PLATE 1/2” P&O 157 LBS DRIVER REAR LEG PLATE 1/2” P&O 172 LBS PASSENGER FRONT LEG PLATE 1/2” P&O 37 LBS PASSENGER FRONT SEAM PLATES 3/8” P&O 18 LBS PASSENBER REAR SEAM PLATES 3/8” P&O 65 LBS DRIVER REAR LEG SEAM PLATES 3/8” P&O 67 LBS FOOT PLATES (ALL)5/8” P&O x(2)@30”D, x(1)@24” D 326 LBS ORANGE SQUARE TUBING 4” X 4” X 1/4” WALL 463 LBS YELLOW SQUARE TUBING 2” X 2” X 1/8” WALL 171 LBS CYAN SQUARE TUBING 3” X 3” X 1/8” WALL 243 LBS SHELL FOAM, FIBERGLASS, EPOXY 1,500 LBS Total 3,586 LBS D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR ARMATURE FRONT ISOMETRICS V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL PASSENGER FRONT ISOMETRIC DRIVER FRONT ISOMETRIC D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR ARMATURE REAR ISOMETRIC V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A 3277 Sun Drive • Eagan, Minnesota 55121 651.287.0900 • www.rhinocentral.com Project: PALO ALTO DINOS Location: PALO ALTO, CA Drawing Title: HADROSAUR ANCHORING/DIMMED V.2.0 Scale: NTS Version: 2.0 Issue Date: 05 • 06 • 19 Notes: Materials: P&O/ERW TUBE STEEL VIEW FROM UNDERNEATH HILTI HIT-Z 3/4” x 9 - 3/4” ANCHOR RODS + HILTI HIT-HY 200 HYBRID MORTAR + 83 11/16"70 5/16" 154 1/16" 8 1/8" 16 3/4" 24 7/8" 5/8” x 24” OD 5/8” x 30” OD 5/8” x 30” OD D D O N LA E I OR R. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 21 Rev. March 29, 2018 EXHIBIT B SCHEDULE OF PERFORMANCE CONTRACTOR shall perform the Services according to the following schedule. Phases may be completed in advance of deadlines. However, CONTRACTOR is responsible for off-site storage if completed in advance (i.e. Sculptures may not be delivered earlier than dates indicated). Jun. 1, 2021 – PHASE 1, Fabrication of full-scale Pteranodon & 50% Fabrication of Aletopelta • Fabrication of Pteranodon (includes coordination with JMZ and scientific advisors to achieve approval on details and coloration); • Storage of sculpture if completed in advance • Completion of interior of full-scale Aletopelta sculpture: steel armature & foam Nov. 1, 2021 – PHASE 2, 100% Fabrication of Aletopelta • Completion of exterior of full-scale Aletopelta sculpture: resin, detailing & painting; • Storage of sculpture if completed in advance Jan. 14, 2022 – PHASE 3, Shipping and Delivery of Pteranodon Jun. 1, 2022 – PHASE 4, 50% Fabrication of Augustynolophus • Completion of interior of full-scale Augustynolophus sculpture: steel armature & foam Nov. 1, 2022 – PHASE 5, 100% Fabrication of Augustynolophus • Completion of exterior of full-scale Augustynolophus sculpture: resin, detailing & painting; • Storage of sculpture if completed in advance Jan. 16, 2023 – PHASE 3, Shipping, Delivery & Installation of Aletopelta and Augustynolophus • Shipment of Aletopelta and Augustynolophus • Onsite management of delivery and installation (NOTE: Installation to be completed by City staff and City-hired crane company) Jan. 31, 2023 – ACCEPTANCE TEST, Two Weeks of Testing With Staff and Visitors; Resolution of Any Issues • Maintenance documentation delivered • Completion of any deficient work DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 22 Rev. March 29, 2018 EXHIBIT C SCHEDULE OF FEES Compensation based upon deliverables CITY shall compensate CONTRACTOR for performance of the Services according to the following schedule, with the maximum amount of compensation not to exceed the amount stated in Sections 5 and 6 of this Agreement: PHASE OF PROJECT DELIVERABLE % OF TOTAL AMOUNT (INCLUDING REIMBURSABLES) 1. PHASE ONE 100% FABRICATION OF PTERANODON & 50% FABRICATION OF ALETOPELTA 20 $42,941.20 Completion of full-scale Pteranodon Storage of sculpture if completed in advance Completion of interior of full-scale Aletopelta sculpture: steel armature & foam 3. PHASE TWO 100% FABRICATION OF ALETOPELTA 15 $32,205.90 Completion of exterior of full-scale Aletopelta sculpture: resin, detailing & painting Storage of sculpture if completed in advance 2. PHASE THREE SHIPPING & DELIVERY OF PTERANODON 1 $2,147.06 4. PHASE FOUR 50% FABRICATION OF AUGUSTYNOLOPHUS 22 $47,235.32 Completion of interior of full-scale Augustynolophus sculpture: steel armature & foam 4. PHASE FIVE 100% FABRICATION OF AUGUSTYNOLOPHUS 22 $47,235.32 Completion of exterior of full-scale Ausgustynolophus sculpture: resin, detailing & painting Storage of sculpture if completed in advance 4. PHASE SIX SHIPPING, DELIVERY & INSTALLATION OF ALETOPELTA & AUGUSTYNOLOPHUS 15 $32,205.90 Shipment of Aletopelta & Augustynolophus Onsite management of delivery & installation (NOTE: Installation to be completed by City staff & City-hired crane company) 4. ACCEPTANCE TEST TWO WEEKS OF TESTING WITH STAFF & VISITORS; RESOLUTION OF ANY ISSUES 5 $10,735.30 Maintenance documentation delivered Completion of any deficient work TOTAL 100% $214,706.00 All Payments are based upon CITY’s acceptance of CONTRACTOR’s performance of the phase as evidenced by successful completion of the Deliverable for that Phase. CITY shall have no obligation to pay unless DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 23 Rev. March 29, 2018 CONTRACTOR has successfully completed and CITY has approved the Project Phase for which payment is due. The maximum amount of compensation to be paid to CONTRACTOR, including both payment for services and reimbursable expenses, shall not exceed the amounts stated in Sections 5 and 6 of the Agreement. Any hours worked for which payment would result in a total exceeding the maximum amount of compensation set forth herein shall be at no cost to CITY. DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 24 Rev. March 29, 2018 EXHIBIT D INSURANCE REQUIREMENTS CONTRACTORS TO THE CITY OF PALO ALTO (CITY), AT THEIR SOLE EXPENSE, SHALL FOR THE TERM OF THE CONTRACT OBTAIN AND MAINTAIN INSURANCE IN THE AMOUNTS FOR THE COVERAGE SPECIFIED BELOW, AFFORDED BY COMPANIES WITH AM BEST’S KEY RATING OF A-:VII, OR HIGHER, LICENSED OR AUTHORIZED TO TRANSACT INSURANCE BUSINESS IN THE STATE OF CALIFORNIA. AWARD IS CONTINGENT ON COMPLIANCE WITH CITY’S INSURANCE REQUIREMENTS, AS SPECIFIED, BELOW: REQUIRED TYPE OF COVERAGE REQUIREMENT MINIMUM LIMITS EACH OCCURRENCE AGGREGATE YES YES WORKER’S COMPENSATION EMPLOYER’S LIABILITY STATUTORY STATUTORY YES GENERAL LIABILITY, INCLUDING PERSONAL INJURY, BROAD FORM PROPERTY DAMAGE BLANKET CONTRACTUAL, AND FIRE LEGAL LIABILITY BODILY INJURY PROPERTY DAMAGE BODILY INJURY & PROPERTY DAMAGE COMBINED. $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 YES AUTOMOBILE LIABILITY, INCLUDING ALL OWNED, HIRED, NON-OWNED BODILY INJURY - EACH PERSON - EACH OCCURRENCE PROPERTY DAMAGE BODILY INJURY AND PROPERTY DAMAGE, COMBINED $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 $1,000,000 NO PROFESSIONAL LIABILITY, INCLUDING, ERRORS AND OMISSIONS, MALPRACTICE (WHEN APPLICABLE), AND NEGLIGENT PERFORMANCE ALL DAMAGES $1,000,000 YES THE CITY OF PALO ALTO IS TO BE NAMED AS AN ADDITIONAL INSURED: CONTRACTOR, AT ITS SOLE COST AND EXPENSE, SHALL OBTAIN AND MAINTAIN, IN FULL FORCE AND EFFECT THROUGHOUT THE ENTIRE TERM OF ANY RESULTANT AGREEMENT, THE INSURANCE COVERAGE HEREIN DESCRIBED, INSURING NOT ONLY CONTRACTOR AND ITS SUBCONSULTANTS, IF ANY, BUT ALSO, WITH THE EXCEPTION OF WORKERS’ COMPENSATION, EMPLOYER’S LIABILITY AND PROFESSIONAL INSURANCE, NAMING AS ADDITIONAL INSUREDS CITY, ITS COUNCIL MEMBERS, OFFICERS, AGENTS, AND EMPLOYEES. I. INSURANCE COVERAGE MUST INCLUDE: A. A PROVISION FOR A WRITTEN THIRTY DAY ADVANCE NOTICE TO CITY OF CHANGE IN COVERAGE OR OF COVERAGE CANCELLATION; AND B. A CONTRACTUAL LIABILITY ENDORSEMENT PROVIDING INSURANCE COVERAGE FOR CONTRACTOR’S AGREEMENT TO INDEMNIFY CITY. C. DEDUCTIBLE AMOUNTS IN EXCESS OF $5,000 REQUIRE CITY’S PRIOR APPROVAL. II. CONTACTOR MUST SUBMIT CERTIFICATES(S) OF INSURANCE EVIDENCING REQUIRED COVERAGE. III. ENDORSEMENT PROVISIONS, WITH RESPECT TO THE INSURANCE AFFORDED TO “ADDITIONAL INSUREDS” DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A City of Palo Alto General Services Agreement 25 Rev. March 29, 2018 A. PRIMARY COVERAGE WITH RESPECT TO CLAIMS ARISING OUT OF THE OPERATIONS OF THE NAMED INSURED, INSURANCE AS AFFORDED BY THIS POLICY IS PRIMARY AND IS NOT ADDITIONAL TO OR CONTRIBUTING WITH ANY OTHER INSURANCE CARRIED BY OR FOR THE BENEFIT OF THE ADDITIONAL INSUREDS. B. CROSS LIABILITY THE NAMING OF MORE THAN ONE PERSON, FIRM, OR CORPORATION AS INSUREDS UNDER THE POLICY SHALL NOT, FOR THAT REASON ALONE, EXTINGUISH ANY RIGHTS OF THE INSURED AGAINST ANOTHER, BUT THIS ENDORSEMENT, AND THE NAMING OF MULTIPLE INSUREDS, SHALL NOT INCREASE THE TOTAL LIABILITY OF THE COMPANY UNDER THIS POLICY. C. NOTICE OF CANCELLATION 1. IF THE POLICY IS CANCELED BEFORE ITS EXPIRATION DATE FOR ANY REASON OTHER THAN THE NON-PAYMENT OF PREMIUM, THE ISSUING COMPANY SHALL PROVIDE CITY AT LEAST A THIRTY (30) DAY WRITTEN NOTICE BEFORE THE EFFECTIVE DATE OF CANCELLATION. 2. IF THE POLICY IS CANCELED BEFORE ITS EXPIRATION DATE FOR THE NON- PAYMENT OF PREMIUM, THE ISSUING COMPANY SHALL PROVIDE CITY AT LEAST A TEN (10) DAY WRITTEN NOTICE BEFORE THE EFFECTIVE DATE OF CANCELLATION. NOTICES SHALL BE MAILED TO: PURCHASING AND CONTRACT ADMINISTRATION CITY OF PALO ALTO P.O. BOX 10250 PALO ALTO, CA 94303 DocuSign Envelope ID: CD4B5B97-3E8A-4343-9240-354A1698A1EE Attachment A Certificate Of Completion Envelope Id: CD4B5B973E8A43439240354A1698A1EE Status: Completed Subject: Please DocuSign: C21180078 Blue Rhino - Legal Revied clean copy.pdf Source Envelope: Document Pages: 39 Signatures: 1 Envelope Originator: Certificate Pages: 2 Initials: 0 Terry Loo AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-08:00) Pacific Time (US & Canada) 250 Hamilton Ave Palo Alto , CA 94301 Terry.Loo@CityofPaloAlto.org IP Address: 199.33.32.254 Record Tracking Status: Original 12/4/2020 10:18:54 AM Holder: Terry Loo Terry.Loo@CityofPaloAlto.org Location: DocuSign Security Appliance Status: Connected Pool: StateLocal Storage Appliance Status: Connected Pool: City of Palo Alto Location: DocuSign Signer Events Signature Timestamp Tim Quady tim.quady@rhinocentral.com President Blue Rhino Studio Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 67.4.29.234 Sent: 12/4/2020 10:22:49 AM Viewed: 12/4/2020 10:49:41 AM Signed: 12/4/2020 10:50:30 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Tina Keegan Tina.Keegan@CityofPaloAlto.org Prod Arts/Sci Prog City of Palo Alto Security Level: Email, Account Authentication (None) Sent: 12/4/2020 10:50:39 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 12/4/2020 10:22:49 AM Certified Delivered Security Checked 12/4/2020 10:49:41 AM Attachment A Envelope Summary Events Status Timestamps Signing Complete Security Checked 12/4/2020 10:50:30 AM Completed Security Checked 12/4/2020 10:50:39 AM Payment Events Status Timestamps Attachment A *NOT YET APPROVED* 1 225_20210331_ts24 Resolution No. ___ Resolution of the Council of the City of Palo Alto to Approve Donor Recognitions at the New Junior Museum and Zoo R E C I T A L S A.In 2015, the Friends of the Palo Alto Junior Museum and Zoo (Friends) launched a $25 million fundraising campaign to rebuild the City’s Junior Museum and Zoo. B.On March 6, 2017, the City Council approved Resolution 9669, which set out a naming and recognition plan for the new Junior Museum and Zoo, consistent with the City’s policies and procedures for naming recognition for significant donations to capital fundraising campaigns. C.The Friends met their campaign goal thanks to many donors, and construction started on the new facility in 2018. D.The new facility is nearing completion, and the rebuilt Junior Museum and Zoo is scheduled to open in late 2021. E.The City Council now desires to approve certain donor recognitions within the new Junior Museum and Zoo as recommended by the Friends. NOW, THEREFORE, the Council of the City of Palo Alto RESOLVES as follows: SECTION 1. The City Council approves the specific donor recognitions within the new Junior Museum and Zoo as detailed in the memo from the Friends (dated March 15, 2021), attached to this Resolution as Exhibit A. SECTION 2. CEQA. The new Junior Museum and Zoo has been evaluated under CEQA. In December 2017, the City Council adopted Resolution 9727 which approved a Mitigated Negative Declaration and Mitigation Monitoring and Reporting Program for the new Junior Museum and Zoo. // // // // Attachment B *NOT YET APPROVED* 2 225_20210331_ts24 SECTION 3. Effective Date. This resolution shall be effective immediately upon passage. INTRODUCED AND PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: __________________________ _____________________________ City Clerk Mayor APPROVED AS TO FORM: APPROVED: __________________________ _____________________________ Deputy City Attorney City Manager _____________________________ Director of Community Services Attachment B Memorandum To: Palo Alto City Council From: Aletha Coleman, Board Co-President Lauren Angelo, Board Co-President Friends of the Palo Alto Junior Museum & Zoo Date: March 15, 2021 Re: Naming and Recognition Plan for the rebuilt Palo Alto Junior Museum & Zoo The Friends of the Palo Alto Junior Museum & Zoo (Friends) is pleased to report that construction of the new Palo Alto Junior Museum & Zoo (JMZ) is nearly complete. This milestone comes after a decade-long effort to realize a new JMZ facility. The Friends raised $25 million in 2017 towards this effort, thanks to the support of donors and the local community, and began construction in 2018. The Friends’ Board of Directors is grateful to the City of Palo Alto for its collaboration and support to rebuild the Junior Museum & Zoo. Built in 1941, the old Junior Museum & Zoo building had become inadequate for the extensive early-education science programming that the JMZ provides both on-site and in local elementary schools. The new JMZ will continue this legacy of excellence for early childhood science education, enticing children to fall in love with the world of science and nature. In addition, the new Junior Museum & Zoo will include safer access, improved facilities and increased access for visitors of all abilities. The building has been modernized while retaining the kid-friendly and intimate qualities of the old facility, providing even more unique, educational experiences that are invaluable to children. Owned and operated by the City of Palo Alto for more than 80 years, the JMZ has been a beloved local destination. With more than 184,000 annual visits – parents, caregivers, preschoolers and elementary students – it is a place where undirected, hands-on play with science exhibits and animals inspires children to discover how things work. While the new facility has been under construction, the JMZ has provided unique educational experiences for children at our temporary location at Cubberley Community Center in Palo Alto. Children have continued to enjoy their favorite exhibits, including the Kid-Powered Ball Machine, giant Climbing Web, and Hydropower Machine. Visitors have also been able to see some of their favorite animals, like our skinks, bats, owls and hedgehogs. Exhibit A to ResolutionAttachment B Recognition Opportunities for the New Palo Alto Junior Museum & Zoo The investments from private donors to build the Palo Alto Junior Museum & Zoo have ensured the legacy of this unique community asset. Although recognition opportunities for major investments are outlined below, all donations will be gratefully recognized during opening festivities. Gifts of $10,000 and Above Donations of $10,000 and above made toward construction of the new facility will be recognized on a central donor board. This donor board will be located outside the front entrance of the lobby. The donor board is currently being designed, and recognition names will be displayed in accordance with each donor’s wishes. Gifts of $100,000 and Above Donors who have made gifts of $100,000 and above have been given the opportunity for on-site recognition at the location of an exhibit. The Peery Family will be recognized for their extraordinary gift of $15,000,000 with prominence within the Central Donor Board and in a plaque adjacent to the Central Donor Board dedicated to and honoring the family for the gift. The following sites will be recognized, as detailed in the Site Recognition Table: Site Recognition Adjacent to the Central Donor Board The Peery Family Science Education Wing A gift of Carmen M. Christensen (1913 - 2010) Exhibit Hall An anonymous gift dedicated to all future scientists, explorers and inventors Ball Machine A gift of the Hahn-Harik Family in loving memory of our grandmother, Nazira Harik Issa Baby’s Space A gift of the John & Marcia Goldman Foundation Tortoise Trail A gift of Marissa Mayer & Zachary Bogue / Macallister, Sylvana & Marielle Animal Ambassador Center A gift of The Thelma Doelger Trust for Animals The Dig A gift of Kelly and Clay Bavor Collections Corner A gift of the Cheung Family Attachment B Rainbow Bridge A gift of the Morgan Family Foundation Dawn Redwood Courtyard A gift of the Rotary Club of Palo Alto / Chartered 1922 / Logo Animal Sculptures A gift of Meredith and Nicholas Tan Geodesic Dome A gift of the Ludwick Family Available Recognition Opportunities Donors still have opportunities to have naming recognition at the location of the following exhibits: Exhibit Recognition Value Bench (9 available)$25,000 each Boulder Hop the Bioswale $100,000 Rabbit Meadow $150,000 Our Native Stream $250,000 Raccoon Creek $300,000 Nature Play Under the Pecan Tree $300,000 Science Classroom $300,000 California Dinosaur Garden $300,000 Curious by Nature Science Exhibits $500,000 The Wildlife Circle $500,000 Meerkat Mob $500,000 Kaleidoscope Tunnel $500,000 Attachment B Recognition opportunities and associated gift levels are made in accordance with the Friends’ Board approved Gift Planning Policy. All naming opportunities are contingent upon City Council approval. Maintenance of these spaces will be the responsibility of the City of Palo Alto, consistent with the terms of the gift of the building and zoo to the City. The names will be associated with the exhibits for the duration of the exhibit’s useful life. This request is consistent with Section 3 of the City of Palo Alto Facility naming Policy (Policy 1-15: Naming City-owned land and facilities). We respectfully request the City Council’s approval of this Naming Recognition Plan. Attachment B Attachment B: Naming Recognition Sign Examples Central Donor Board * Site Naming/Recognition Sign * *Examples are concepts, the fonts, materials and placement will be determined during final design and site layout Attachment B LICENSE AGREEMENT BETWEEN THE CITY OF PALO ALTO AND THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY FOR USE OF SPACE AT THE JUNIOR MUSEUM AND ZOO TO CONDUCT RESEARCH This License Agreement (“Agreement”) is entered into as of the last date signed by all Parties below (the “Effective Date”) by and between City of Palo Alto, a California municipal corporation (“City”) and Stanford University (“Licensee”). City and Licensee are each a “Party”, and collectively are “Parties”, to this Agreement, as referred to herein. RECITALS WHEREAS, Licensee desires to use part of the City’s Junior Museum and Zoo facility to conduct University-sanctioned psychological research; and WHEREAS, to further serve the public interest, City desires to license to Licensee certain space located in the Junior Museum and Zoo facility at 1451 Middlefield Road, Palo Alto, CA, commonly referred to as the JMZ (the “Property”), which space is marked on Exhibit A attached hereto, (the “Premises”), to conduct academic research; and NOW THEREFORE for good and valuable considerable as provided for herein, the receipt and adequacy of which is hereby acknowledged by the Parties, the Parties agree to the foregoing and the following: 1. The Premises. The “Premises” shall have the meaning set forth in the Recitals above. 2. Relocation of Premises. At any time after Licensee’s execution of this License, City shall have the right, in City’s sole discretion, upon providing Licensee thirty (30) days' written notice (“Relocation Notice”), to relocate the Premises to a new location in the Property (the “New Premises”). The New Premises shall be described in the Relocation Notice. City will endeavor to provide Licensee with New Premises substantially similar in size, location, and quality to the existing Premises. If City relocates Licensee to the New Premises, then this Agreement and each and all of the agreements, covenants, conditions and provisions of this Agreement shall remain in full force and effect and be applicable to the New Premises, except that (i) a revised floor plan shall become part of this Agreement and shall reflect the location of the New Premises. If Licensee refuses to permit City to move Licensee to the New Premises, City shall have the right to terminate this Agreement following the end of the thirty (30) day notice period. 3. The Term. The Term of this License shall be from March 1, 2021 through and including June 30, 2030 (the "Term"), City hereby grants Licensee a limited, revocable, non-exclusive, non- assignable and temporary license, subject to all of the terms and conditions contained herein. This Agreement shall be on an “at-will” basis, terminable upon one (1) year’s advance written notice provided by either Party to the other for any or no reason. For emergency purposes or for other City priority needs, City may terminate this Agreement or temporarily cancel or discontinue Licensee’s use of the Premises without advance notice and without any liability. In addition, if City determines in its sole and absolute discretion that Licensee has violated or breached any term or condition of this Agreement, City may terminate this Agreement immediately, within its sole discretion, without notice and without liability. Upon cancellation, termination or expiration of this Agreement, Licensee shall ensure for itself and for all vendors, guests, visitors, contractors, subcontractors, agents and representatives, that the Premises are immediately surrendered to City in as good or better condition as of the Effective Date of this Agreement, reasonable wear and tear excepted. Should Licensee fail to remove or dispose of personal property at the end of the DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C Term or earlier termination of this Agreement, City may consider the property abandoned and may claim proper title to it or dispose of it at Licensee’s expense. 4. Use of Premises. Licensee covenants, represents, warrants and agrees that all of the following terms and conditions shall be met at all times during the Term: a. During the Term, the Premises will be used solely for the Permitted Use, which is defined as follows: i. Up to four Stanford staff and students at any one time may use the Premises to conduct psychological research sanctioned by Stanford University and its Institutional Review Board. More than four staff and students may be permitted with written permission by the JMZ Director. ii. All Stanford staff and students must be identified clearly with name badges and/or apparel as approved by the JMZ Director. iii. Licensee shall not enter or use the Premises during City’s non-business hours without written permission from City. iv. Using the Premises primarily as storage is expressly not permitted. b. Licensee hereby accepts the Premises for use in its "AS-IS" "WHERE-IS" "WITH ALL FAULTS" condition. c. Other than in connection with the Permitted Use, Licensee will not, nor will Licensee allow anyone else to, park on, remove, relocate, alter, attach anything to, or otherwise modify the Premises, without the prior written consent in each instance of the City, which consent may be granted or withheld in the City’s sole and absolute discretion. Purely cosmetic and decorative modification, including the installation of furniture, signage, and technology that is not affixed to the Premises by the Licensee is permitted without prior written consent from City. d. Licensee shall at all times maintain the Premises, in good repair and in a clean, neat, sanitary and safe condition in a manner fully compliant with all applicable laws, regulations, permits and standards. Licensee shall at all times refrain from (and cause representatives and occupants to refrain from) placing, storing and/or using any Hazardous Materials at the Premises, and promptly remove any and all garbage and/or debris placed onto the Premises regularly throughout and prior to the end of the Term. Licensee shall be responsible for repairing to the City’s satisfaction or reimbursing the City for any damage caused by Licensee or its vendors, guests, visitors, contractors, subcontractors, agents and representatives. e. Licensee shall obtain, maintain and pay for all permits and licenses that may be or are required for the use of the Premises by Licensee and for any work on or reconfiguration of the Property. f. City shall provide power and other utilities in amounts reasonable with Licensee’s Permitted Use. However, Licensee agrees that City shall not be liable to Licensee for its failure to provide power and other utilities when such failure is occasioned, in whole or in part, by repairs, replacements, or improvements, by any strike, lockout or other labor trouble, by inability to secure electricity, gas, water, telephone service or other utility at the Property, by any accident, casualty or event arising from any cause whatsoever, including the negligence of City, its employees, agents and contractors, by act, negligence or default of Licensee or any other person or entity, or by any other cause, and such failures shall never be deemed to constitute an eviction or disturbance of Licensee’s use and possession of the Premises or relieve Licensee from the obligation of performing any of its obligations under this Agreement. Furthermore, City shall not be liable under any circumstances for loss of property or for injury to, or interference with, Licensee’s business, including, without limitation, loss of profits, however occurring, through or in DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C connection with or incidental to a failure to furnish any such utilities. City may comply with voluntary controls or guidelines promulgated by any governmental entity relating to the use or conservation of energy, water, gas, light or electricity or the reduction of automobile or other emissions without creating any liability of City to Licensee under this Agreement. 5. Consideration. a) Fee. In consideration for the use of the Premises under this Agreement, Licensee agrees to the terms of this Agreement. City will not charge Licensee a monthly rent or fee for use of the Premises. b) Security Deposit. None. 6. Insurance. Licensee and Licensee’s contractors and subcontractors performing or carrying out the Permitted Use shall at its/their own expense, but for the mutual benefit of City and Licensee, maintain the insurance specified in Exhibit B, attached hereto. 7. Waiver, Indemnity, Limitation on Liability. Licensee covenants, warrants, represents and agrees that: a) To the fullest extent permitted by law, and as a material part of the consideration to City for granting the license, excluding any Claims that are the direct result of the sole gross negligence or willful misconduct of City, Licensee hereby forever releases City and all officers, agents and employees from responsibility and liability for, waive entire claim of recovery for, and assumes all risk of: (i) damage to property or injury to persons (including death) in, at or on the Premises from any cause whatsoever during the Term; (ii) damage to property or injury to persons (including death) as a result of events occurring outside or in the vicinity of the Premises during the Term; and (iii) business or meeting interruption or other consequential damages. No defense, indemnification or hold harmless obligations hereunder shall relieve any insurance carrier of its obligations under any insurance policies carried by any Party or third party pursuant to this Agreement. This waiver shall survive the expiration, termination or cancellation of this Agreement. The City shall be entitled to recover its reasonable attorney’s fees and court costs incurred in enforcing this waiver, defense and hold harmless obligations. b) Licensee accepts and acknowledges that it or they may have rights under California Civil Code § 1542 which reads as follows: A GENERAL RELEASE DOES NOT EXTEND TO CLAIMS THAT THE CREDITOR OR RELEASING PARTY DOES NOT KNOW OR SUSPECT TO EXIST IN HIS OR HER FAVOR AT THE TIME OF EXECUTING THE RELEASE AND THAT, IF KNOWN BY HIM OR HER, WOULD HAVE MATERIALLY AFFECTED HIS OR HER SETTLEMENT WITH THE DEBTOR OR RELEASED PARTY. Licensee, however, hereby assumes the unknown or unanticipated risks associated with this Agreement, and upon advice of counsel, Licensee does hereby knowingly waive any and all rights and protections under California Civil Code Section 1542, as well as any similar applicable law of any local, state or territory of the United States. c) Licensee shall also indemnify, defend, save and hold harmless City as set forth in Exhibit B attached hereto. DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C d) EXCEPT AS OTHERWISE EXPRESSLY PROVIDED FOR IN THIS AGREEMENT, TO THE FULLEST EXTENT ALLOWED BY LAW, THE CITY AND ITS OFFICERS, EMPLOYEES AND AGENTS SHALL NOT BE LIABLE FOR ANY CONSEQUENTIAL, INCIDENTAL, INDIRECT, EXEMPLARY, SPECIAL OR PUNITIVE DAMAGES, REGARDLESS OF WHETHER THE CLAIM GIVING RISE TO SUCH DAMAGES IS BASED UPON BREACH OF WARRANTY, BREACH OF CONTRACT OR NEGLIGENCE, EVEN IF EITHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY THEREOF. 8. Real Estate Provisions. a. No Lease. No legal title, leasehold interest or other interest in or to the Premises or appurtenances thereto shall be construed to have been created or vested in Licensee or any of Licensee’s employees, officers, managers, contractors, subcontractors, agents, representatives or affiliates (collectively, “Licensee Representatives”) as a result of this Agreement, or the use or occupancy of the Premises by Licensee or anyone else. IF APPLICABLE, LICENSEE WAIVES ANY AND ALL RIGHTS OFFERED TO TENANTS OF COMMERCIAL REAL PROPERTY UNDER FEDERAL, STATE AND LOCAL LAWS AND ORDINANCES, INCLUDING BUT NOT LIMITED TO CALIFORNIA CODE OF CIVIL PROCEDURE SECTIONS 1161 AND FOLLOWING. b. Mechanics Liens. Licensee shall not allow any mechanic’s or other liens to be made against the Premises and shall indemnify and save harmless City against all costs, liabilities, suits, claims and demands, including legal fees and court costs, resulting from any such liens. c. Assignment or Subletting. This Agreement may not be assigned, sublet, licensed, transferred, mortgaged, encumbered, or otherwise disposed of, without the prior written approval of the City, which consent may be granted or withheld in City’s sole and absolute discretion. d. No Smoking-Policy. Smoking is prohibited anywhere on or in the Premises. Licensee shall enforce and shall ensure that all Licensee Representatives enforce this no smoking requirement anywhere on or in the Premises during the Term. e. Accessibility Standards Notice. As may be required by Section 1938(a) of the California Civil Code, City discloses to Licensee that the Premises have not undergone inspection by a certified access specialist (“CASp”). As required by Section 1938(e) of the California Civil Code, City also states that: “A CASp can inspect the Premises and determine whether the Premises complies with all of the applicable construction-related accessibility standards under state law. Although state law does not require a CASp inspection of the Premises, the commercial property owner or lessor may not prohibit the licensee from obtaining a CASp inspection of the Premises for the occupancy or potential occupancy of the licensee, if requested by the licensee. The parties shall mutually agree on the arrangements for the time and manner of the CASp inspection, the payment of the fee for the CASp inspection, and the cost of making any repairs necessary to correct violations of construction-related accessibility standards within the Premises.” Any CASp inspection elected to be conducted by Licensee shall be done at Licensee’s sole cost and expense, and to the extent that a CASp inspection identifies any necessary repairs to correct violations of construction-related accessibility standards, Licensee shall be DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C responsible to correct such violations. f. Hazardous Materials. Licensee shall not cause, nor shall Licensee allow anyone to cause, any Hazardous Material (as defined below) to be sold, offered for sale, released, brought upon, kept, used, stored, generated or disposed of in, on or about the Premises. All waste, including any Hazardous Waste, generated as a result of the operation shall not be left, stored or disposed of on the Premises. For purposes hereof, “Hazardous Material” means, but is not limited to, material that, because of its quantity, concentration or physical or chemical characteristics, is at any time now or hereafter deemed by any federal, state or local governmental authority to pose a present or potential hazard to public health, safety, welfare or the environment, including but not limited to consumer safety and health. The meaning of “Hazardous Material” as used herein also includes, without limitation, any material or substance defined as a “hazardous substance, pollutant or contaminant” pursuant to the Comprehensive Environmental Response, Compensation and Liability Act of 1980, as amended, 42 U.S.C. Sections 9601 et seq., or pursuant to Section 25316 of the California Health & Safety Code; a “hazardous waste” listed pursuant to Section 25140 of the California Health & Safety Code; any asbestos and asbestos containing materials whether or not such materials are part of the Premises or are naturally occurring substances in the Premises; any chemical, content or product failing to meet the applicable standards imposed by regulation or other law falling within the jurisdiction of the U.S. Consumer Product Safety Commission, the U.S. Department of Transportation, the U.S. Environmental Protection Agency, the U.S. Federal Trade Commission, the U.S. Food and Drug Administration, U.S. Department of Agriculture, or any local or state agency or department of equivalent or similar jurisdiction or authority; and/or any other similarly regulated product, substance or chemical containing regulated levels of lead, phthalates, bloodborne pathogens, bio-waste, medical waste, pesticides, those products for which a pesticidal claims is made, and/or pharmaceuticals. The meaning of Hazardous Material, as used herein, shall also include any petroleum, including, without limitation, crude oil or any fraction thereof, natural gas or natural gas liquids. Notwithstanding the foregoing, Licensee may use reasonable amounts of cleaning supplies in connection with the Permitted Use and may have fuel in its vehicles in standard amounts necessary to operate the same, in compliance with applicable law. g. OFAC. Licensee represents, warrants and agrees that at times herein: (i) neither Licensee nor any of the Licensee Representatives are acting or will act, directly or indirectly, for or on behalf of any person, group, entity, or nation named by any Executive Order or the United States Treasury Department as a terrorist, “Specially Designated National and Blocked Person,” or other banned or blocked person, entity, nation, or transaction pursuant to any law, order, rule or regulation enforced or administered by the federal Office of Foreign Assets Control; and (ii) neither Licensee nor any of the Licensee Representatives is or are engaged in this transaction, directly or indirectly, on behalf of, or instigating or facilitating this transaction, directly or indirectly, on behalf of any such person, group, entity, or nation. h. No Relocation Assistance. It is understood that this Agreement is intended to give Licensee a temporary use of the Premises and that Licensee shall not be entitled to relocation benefits, assistance, damages (liquidated or otherwise), costs, claims or fees from City upon expiration, termination or cancellation of this Agreement. i. Possessory Interest Tax. Licensee acknowledges that its interest in and/or use of the Premises may be subject to possessory interest taxation and that such taxation shall be DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C Licensee’s sole responsibility and liability. 9. City Provisions. a. Relationship of City and Licensee. The Parties acknowledge and agree that nothing set forth in this Agreement shall be deemed or construed to render City and Licensee or City and any of the Licensee Representatives as joint venture’s, partners, associations, master- servant, agents, a joint enterprise, employer-employee, lender-borrower or contractors of each other or of any of their representatives. Licensee’s status, as well as the status of the Licensee Representatives, shall be in an independent capacity and not as an employee or agent of the City. b. Prevailing Wage. Licensee acknowledges and agrees that construction or improvement work performed under this Agreement may be considered a public work within the meaning of California Labor Code Section 1720 and that the requirements of Section 1771, et. seq. apply to such public work. Licensee is solely responsible and liable for ensuring compliance with all applicable prevailing wage laws. c. City Regulatory Authority. Licensee understands, acknowledges, accepts and agrees that City is entering into this Agreement in its capacity as a property owner with a proprietary interest in the Premises and not as a regulatory agency with police powers. Nothing herein shall limit in any way Licensee's obligation to obtain any required regulatory approvals from City departments, boards or commissions or other governmental regulatory authorities or limit in any way City’s exercise of its police powers. d. Wage Theft Prevention. Licensee, and any the Licensee Representatives it employs or contracts with to complete work under this Agreement, must comply with all applicable federal, state, and local wage and hour laws. Applicable laws may include, but are not limited to, the Federal Fair Labor Standards Act, the California Labor Code, and any local Minimum Wage Ordinance or Living Wage Ordinance. If Licensee is found by a court or by final administrative action of an investigatory government agency to have violated applicable wage and hours laws, in the five years prior to or during the term of this License, such violation will be considered a material breach of this License and may serve as a basis for Licensee to terminate this License. e. Nondiscrimination. Licensee and each of the Licensee Representatives shall comply with all laws and City of Palo Alto policies concerning nondiscrimination and equal opportunity in contracting. Such laws include but are not limited to the following: Title VII of the Civil Rights Act of 1964, as amended; Americans with Disabilities Act of 1990; The Rehabilitation Act of 1973 (Sections 503 and 504); California Fair Employment and Housing Act (Government Code Sections 12900 et sea.); California Labor Code sections 1101 and 1102. Licensee and each of the Licensee Representatives shall not discriminate against any contractor, subcontractor, employee, or applicant for employment because of age, race, color, national origin, ancestry, religion, sex/gender, sex or gender identity, sexual orientation, mental disability, physical disability, medical condition, political beliefs, organization affiliations, or marital status in the recruitment, selection for training including apprenticeship, hiring, employment, utilization, promotion, layoff, rates of pay or other forms of compensation, nor shall Licensee or any of the Licensee Representatives discriminate in the provision of services provided under this License because of age, race, color, national origin, ancestry, religion, sex/gender, sex or gender identity, sexual orientation, mental disability, physical disability, medical DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C condition, political beliefs, organizational affiliations, or marital status. 10. Miscellaneous. a. Notices. All notices which are required to be given hereunder, or which either Party may wish to give, shall be in writing and shall be served either by personal delivery or by certified or registered mail, postage prepaid, addressed as follows (or to such other place(s) as such Party may designate by written notice): To City: City of Palo Alto 250 Hamilton Avenue Palo Alto, CA 94301 Attn: Real Property Manager With a copy to: City of Palo Alto 250 Hamilton Avenue Palo Alto, CA 94301 Attn: JMZ Director To Licensee: Department of Psychology Stanford University 450 Jane Stanford Way Building 01-420 Stanford, CA 94305 Attn: Director of Finance and Administration With a copy to: Department of Psychology Stanford University 450 Jane Stanford Way Building 01-420 Stanford, CA 94305 Attn: Professor Hyo Gweon b. Joint and Several; Covenants and Conditions. If Licensee consists of more than one person or entity, the obligations of all such persons or entities shall be joint and several. Each provision to be performed by Licensee hereunder shall be deemed to be both a covenant and a condition. c. No Third-Party Rights. This Agreement does not, and is not intended to, confer any rights or remedies upon any person or entity other than the Parties. d. Waiver. No delay or failure to require performance of any provision of this Agreement shall constitute a waiver of that provision as to that or any other instance. Any waiver DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C granted by a party shall be in writing and shall apply to the specific instance expressly stated. e. Governing Law; Exclusive Jurisdiction. This Agreement has been executed and delivered in, and shall be construed and enforced in accordance with, the laws of the State of California. Proper venue for legal action regarding this Agreement shall be in the County of Santa Clara. f. Counterparts; Electronic/Digital Signatures. This Agreement may be executed in any number of counterparts, and all of such counterparts so executed together shall be deemed to constitute one and the same agreement, and each such counterpart shall be deemed to be an original provided all of the Parties have fully executed this Agreement. Unless otherwise prohibited by law or City policy, the parties agree that an electronic copy of this Agreement, or an electronically signed Agreement, has the same force and legal effect as the Agreement executed with an original ink signature. The term “electronic copy of this Agreement” refers to a transmission by facsimile, electronic mail, or other electronic means of a copy of the original signed Agreement in a portable document format. The term “electronically signed Agreement” means the Agreement that is executed by applying an electronic signature using technology approved by the City. g. Construction. This Agreement constitutes the final, complete and exclusive statement of the terms of the agreement between the Parties. It incorporates and supersedes all the agreements, covenants and understandings between the Parties concerning the subject matter hereof, and all such agreements, covenants and understandings have been merged into this Agreement. No prior or contemporaneous agreement or understanding, verbal or otherwise, of the Parties or their agents shall be valid or enforceable unless embodied in this Agreement. This Agreement may only be amended by a written instrument signed by the Parties. h. Signing Authority. By signing this Agreement, each signatory for a Party warrants and represents that he/she executed this Agreement in his/her authorized capacity, that he/she has the authority to bind the entity or person for whom he/she signs to contractual obligations and that, by his/her signature, the entity or person on behalf of which he/she acted executed this Agreement. i. Survival. Those Sections and provisions that by their nature should survive termination, cancellation or expiration of this Agreement, shall so survive, including but not limited to Sections 6 through 9, inclusive. /// SIGNATURES FOLLOW ON NEXT PAGE //// // // DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C IN WITNESS WHEREOF, the Parties hereto have executed this Agreement on the dates provided below. CITY: City of Palo Alto, a California municipal corporation By: City Manager Date: APPROVED: Director, Community Services APPROVED AS TO FORM: Deputy City Attorney LICENSEE: The Board of Trustees of the Leland Stanford Junior University, an institution of higher education having corporate powers under the State of California By: Steve Olson Senior Associate Dean for Finance and Administration, School of Humanities and Sciences Date: DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD 12/4/2020 Attachment C EXHIBIT A – DESCRIPTION OF PREMISES The Premises under this Agreement shall be that space within the City’s Junior Museum and Zoo building located at 1451 Middlefield Road, Palo Alto, California marked as “Stanford Space” on the following page. DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C DN SD 5 663 SF 14 OCC. SHOP 50 1 EXIT(S) B 312 SF GIRLS RESTROOM 287 SF BOYS RESTROOM 108 SF 2 OCC. ZOO WORK SPACE 100 1 EXIT(S) B 48 SF 1 OCC. JAN. CLOSET 300 1 EXIT(S) S-1 160 SF 2 OCC. ANIMAL CARE 100 1 EXIT(S) B 831 SF 119 OCC. MULTI-USE ROOM 7 2 EXIT(S) A-3 677 SF 7 OCC. PROGRAM ANIMAL ROOM 100 1 EXIT(S) B 79 SF RESTROOM 85 SF 1 OCC. STORAGE 300 1 EXIT(S) S-1 64 SF 1 OCC. VESTIBULE 100 1 EXIT(S) B 118 SF 2 OCC. QUARANTINE 100 1 EXIT(S) B 108 SF 1 OCC. GENERAL STORAGE 300 1 EXIT(S) S-1 95 SF 1 OCC. PLUMBING 100 1 EXIT(S) S-1 158 SF 2 OCC. TRASH ENCLOSURE 100 1 EXIT(S) S-1 112 SF 8 OCC. SMALL CONF. RM. 15 1 EXIT(S) B 155 SF 11 OCC. CONF. RM. 15 1 EXIT(S) B 108 SF RR AND SHOWER 136 SF 2 OCC. FRIEND'S OFFICE 100 1 EXIT(S) B 876 SF 44 OCC. CLASSROOM 20 1 EXIT(S) E 69 SF 1 OCC. STORAGE 300 1 EXIT(S) S-1 1144 SF 4 OCC. COLLECTIONS HUB 300 1 EXIT(S) S-1 208 SF 1 OCC. CLIMATE CONTR. STORAGE 300 1 EXIT(S) S-1 177 SF 1 OCC. LONG TERM BIKE STORAGE 300 1 EXIT(S) S-1 83 SF 1 OCC. GENERAL STORAGE 300 1 EXIT(S) S-1 209 SF 1 OCC. ELEC./DATA 300 1 EXIT(S) S-1 79 SF CLASSROOM RESTROOM 1 1 1 1 45 1 11 8 1 2 1 1 2 10 186 192 1 1 2 6 60 60 34 2 2 3 FEC FEC FEC FEC FEC FEC FECFEC 14 FEC DF PH PH PH PH COMMON PATH OF EGRESS TRAVEL = 70'-0" < 100'-0" CO M M O N P A T H O F E G R E S S T R A V E L = 90 ' -6 1 / 2 " < 1 0 0 ' -0" SEE ZOO PLAN EGRESS COURT 107 EGRESS COURT 106 PH RAINBOW TUNNEL E XIT S E P A R A TIO N = 47' - 4" > 34' - 6" PH PH PH 218 SF 8 OCC. LOBBY 30 1 EXIT(S) A-3 3714 SF 248 OCC. EXHIBITS GALLERY 15 2 EXIT(S) A-3 148 SF 2 OCC. TICKETING/RECEPTION 100 1 EXIT(S) B 161 160 DF 2999 SF 200 OCC. DAWN REDWOOD COURTYARD 15 2 EXIT(S) A-3 2 EXIT GATE OCC. LOAD CAP. FACTOR REQ'D WIDTH ACTUAL WIDTH 252 0.15 37.8" 42" 252 ACTUAL WIDTH REQ'D WIDTH CAP. FACTOR OCC. LOAD EXIT DOOR 72" 24" 161 0.15 ACTUAL WIDTH REQ'D WIDTH CAP. FACTOR OCC. LOAD EXIT DOOR 31" 72" 156 0.2 ACTUAL WIDTH REQ'D WIDTH CAP. FACTOR OCC. LOAD EXIT GATE 38 1/2" 72" 192 0.2 EX I T A C C E S S T R A V E L D I S T A N C E = 1 6 7 ' -0" < 2 5 0 ' -0" 1 /3 D I A G O N A L = 6 6'-5 " M A X . D I A G O N A L = 1 9 9' - 3 " FEC 156PH 36 " 1142 SF 12 OCC. OPEN OFFICE 100 1 EXIT(S) B 96 SF 1 OCC. BREAK ROOM 100 1 EXIT(S) B 1 > 6 6 ' - 5 " E X I T S E P A R A T I O N = 1 7 7 ' 252 PH 1/3 D I A G O N A L = 3 1' M A X D I A G O N A L = 9 0' - 2" PH PH EXIT GATE OCC. LOAD CAP. FACTOR REQ'D WIDTH ACTUAL WIDTH 252 0.15 37.8" 42" EXIT DOOR OCC. LOAD CAP. FACTOR REQ'D WIDTH ACTUAL WIDTH 160 24" 72" 0.15 D C C C C B G F J H B B B B B B B B B B B B B B B BBB B B B B B D D A A A A C C C C C C C C C C C C C C R R R E R E L K K L K L PH A2 A2 DN FENCE FENC E A3 A2 A2 A3 *NOTE: SF EXCLUDES ANIMAL ENCLOSURE SPACES NOTE: SERVICE DOOR ONLY - EGRESS DOOR NO T * PH SL O P E D W A L K W A Y ( 4 . 5 % ) . SE E 1 & 2 / L 4 . 7 A2 3 STAIRS DOWN, SEE 7/L4.3 361 SF 4 OCC. ANIMAL SUPPLY 100 1 EXIT(S) B SERVICE YARD 107 WH WH EXIT DOOR OCC. LOAD CAP. FACTOR REQ'D WIDTH ACTUAL WIDTH 186 .2 37.2 42" A2 A2 A2 A2 A2 E X I T S E P A R A T I O N = 5 0 ' - 7 1 / 2 " > 3 1 ' A2 A2 A2 EXHIBITS GALLERY & SECONDARY EXHIBITS GALLERY A3 A3 A3 24.14" A3 A3 A3 8' - 1" 8' - 1" A3 A3 A3 A3 A3 A3 A3 COMMON PATH OF EGRESS TRAVEL = 43'-3" < 75' A3 A3 A3 A3 *MAIN EXIT FROM EXHIBIT GALLERY: 1/2 OCCUPANT LOAD 124 SF 2 OCC. STANFORD SPACE 100 1 EXIT(S) B B14 2 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 B14 CODE ANALYSIS LEGEND OCCUPANCY LOAD SUMMARY CBC TABLE 1004.1.2ROOM SF ROOM NAME LOAD FCTR # OCC. # EXIT(S) OCC TYPE ROOM NAME X SF DOOR SUMMARY GATE SUMMARY ROOM AREA: NOT OCCUPIED OCCUPANT LOAD AT EXIT/ACCESS 33 33 FE FEC PH OCCUPANT LOAD AT EXIT ACCESSIBLE DRINKING FOUNTAIN MAXIMUM EXIT ACCESS TRAVEL DISTANCE WALL MOUNTED FIRE EXTINGUISHER FIRE EXTINGUISHER CABINET SEMI RECESSED PANIC HARDWARE MAXIMUM COMMON PATH OF EGRESS TRAVEL DOUBLE EGRESS GATE ACTUAL WIDTH REQ'D WIDTH CAP. FACTOR OCC. LOAD EXIT DOOR X" X X X" ACTUAL WIDTH REQ'D WIDTH CAP. FACTOR OCC. LOAD EXIT GATE X" X X X" DF INTERIOR SIGNAGE LEGEND SEE A0.03 PROPERTY LINE DAWN REDWOOD COURTYARD FENCE BOUNDARY A2 NON-RATED EXTERIOR WALL ASSEMBLY 1HR-RATED EXTERIOR WALL ASSEMBLY NET OCCUPIABLE AREA BY HUMANS INTERIOR SIGNAGE LEGEND A. B. C. D. E. F. G. H. J. K. L. R. TYP. TACTILE EXIT SIGN: SEE 4A/A9.92 TYP. ROOM TACTILE ID SIGN: SEE 4B/A9.92 TACTILE EXIT ROUTE SIGN: SEE 4C/A9.92 ACCESSIBLE ENTRY SIGN: SEE 4D/A9.92 OCCUPANCY SIGNAGE: SEE 4E/A9.92 MEN'S RESTROOM WALL SIGN: SEE 2F/A9.92 MEN'S RESTROOM DOOR SIGN: SEE 2G/A9.92 WOMEN'S RESTROOM WALL SIGN: SEE 2H/A9.92 WOMEN'S RESTROOM DOOR SIGN: SEE 2J/A9.92 GENDER NEUTRAL RESTROOM WALL SIGN: SEE 2K/A9.92 GENDER NEUTRAL RESTROOM DOOR SIGN: SEE 2L/A9.92 ALS SIGNAGE: SEE 3/A9.92 DAWN REDWOOD COURTYARD OPERATIONAL USE STATEMENT: THE COURTYARD IS PART OF THE JMZ VISITOR EXPERIENCE PROVIDING VALUABLE AND EXCITING OUTDOOR VISITOR EXPERIENCES THEME AROUND A CALIFORNIA DINOSAUR GARDEN: DECK WITH SEATING AND GATHERING AREAS, EDUCATIONAL AND EXHIBIT SIGNAGE EXPLAINING TREES AND PLANTINGS, FOSSIL GRAVEL PIT DIG AREA, AND SCALE DINOSAUR SCULPTURES. THE COURTYARD PROVIDES EXTERIOR CIRCULATION BETWEEN EXHIBIT GALLERY, MULTI-USE ROOM, STAFF OFFICES, CLASSROOM AND COLLECTIONS HUB. THE COURTYARD ALSO PROVIDES EGRESS CIRCULATION FOR MANY SPACES OF THE BUILDING. ALL CIRCULATION IS ON RAISED DECK. THE COURTYARD IS ENCLOSED BY BUILDING ON THREE SIDES AND FENCING ON THE FOURTH. CONSULTANTS STAMP SHEET TITLE PROJECT NAME PROJECT NO. DRAWN BY CHECKED BY SHEET 12 / 1 8 / 1 8 1 : 0 4 : 2 2 P M CODE ANALYSIS FRIENDS OF THE JMZ 1451 MIDDLEFIELD ROAD JUNIOR MUSEUM AND ZOO PALO ALTO, CA 94301 NEW CONSTRUCTION A0.03 L. Schultz, J. Cadouri S.Vaccaro, B. McClure 11011 1/8" = 1'-0"1 CODE ANALYSIS - BUILDING A2 A2 MILESTONE DATE FORMAL ARB RESUBMITTAL 8/31/17 DESIGN DEVELOPMENT 11/3/17 PERMIT SUBMITTAL 3/7/18 A1 BID SET 4/16/18 A2 BUILDING PERMIT RESUBMITTAL 5/16/18 A3 BUILDING PERMIT SET 6/22/18 B14 BULLETIN 14 11/29/18 DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C EXHIBIT B – INSURANCE REQUIREMENTS Insurance Requirements for Licensee: Licensee shall purchase and maintain the insurance policies set forth below on all of its operations under this License at its sole cost and expense. Such policies shall be maintained for the full term of this License and the related warranty period (if applicable). For purposes of the insurance policies required under this License, the term "City" shall include the duly elected or appointed council members, commissioners, officers, agents, employees and volunteers of the City of Palo Alto, California, individually or collectively. Coverages (RL 28.1A) S Minimum Scope of Insurance Coverage shall be at least as broad as: 1) Insurance Services Office Commercial General Liability coverage (occurrence form CG 0001). 2) Insurance Services Office form number CA 0001 (Ed. 1/87) covering Automobile Liability, code 1 (any auto). 3) Workers' Compensation insurance as required by the State of California and Employer's Liability Insurance (for Licensees with employees). 4) Premises insurance against all risks of loss to any Licensee improvements or betterments The policy or policies of insurance maintained by Licensee shall provide the following limits and coverages: POLICY MINIMUM LIMITS OF LIABILITY (1) Commercial General Liability $1,000,000 per each occurrence and $2,000,000 in the aggregate for bodily injury, personal injury and Premises damage (2) Automobile Liability $ 1,000,000 Combined Single Limit Including Owned, Hired and Non-Owned Automobiles (3) Workers’ Compensation Statutory Employers Liability $1,000,000 per accident for bodily injury or disease (4) Licensee’s Premises Insurance Licensee shall procure and maintain Premises insurance coverage for: DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C (a) all office furniture, trade fixture, office equipment, merchandise, and all other items of Licensee’s Premises in, on, at, or about the premises and the building, include Premises installed by, for, or at the expense of Licensee; (b) all other improvements, betterments, alterations, and additions to the premises. Licensee’s Premises insurance must fulfill the following requirements: (a) it must be written on the broadest available “all risk” policy form or an equivalent form acceptable City of Palo Alto, including earthquake sprinkler leakage. (b) for no less than ninety percent (90%) of the full replacement cost (new without deduction for depreciation) of the covered items and Premises; and (c) the amounts of coverage must meet any coinsurance requirements of the policy or policies. (RL 28.2) Deductibles and Self-Insured Retentions Any deductibles or self-insured retentions must be declared to and approved by City. At the option of City, either: the insurer shall reduce or eliminate such deductibles or self-insured retentions as respects City, its officers, officials, employees and volunteers; or the Licensee shall procure a bond guaranteeing payment of losses and related investigations, claim administration and defense expenses. Insurance shall be in full force and effect commencing on the first day of the term of this License. Each insurance policy required by this License shall: 1. Be endorsed to state that coverage shall not be suspended, voided, canceled by either party, reduced in coverage or in limits except after thirty (30) days' prior written notice by certified mail, return receipt requested, has been given to City. 2. Include a waiver of all rights of subrogation against City and City Council members and elective or appointive officers or employees, and each party shall indemnify the other against any loss or expense including reasonable attorney fees, resulting from the failure to obtain such waiver. 3. Name “City of Palo Alto” as a loss payee on the Premises’ policy. 4. Provide that City, its officers, officials, employees, agents and volunteers are to be covered as insureds as respects: liability arising out of activities performed by or on behalf of Licensee; products and completed operations of Licensee; premises owned, occupied or used by Licensee; or automobiles owned, Licensed, hired or DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C borrowed by Licensee. The coverage shall contain no special limitations on the scope of protection afforded to City, its officers, officials, employees, agents or volunteers. 5. Provide that for any claims related to this License, the Licensee’s insurance coverage shall be primary insurance as respects City, its officers, officials, employees, agents and volunteers. Any insurance or self-insurance maintained by City, its officers, officials, employees, agents or volunteers shall be excess of Licensee’s insurance and shall not contribute with it. 6. Provide that any failure to comply with reporting or other provisions of the policies including breaches of warranties shall not affect coverage provided to City, its officers, officials, employees, agents or volunteers. 7. Provide that Licensee’s insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer's liability. 8. Licensee agrees to promptly pay to City as Additional Rent, upon demand, the amount of any increase in the rate of insurance on the Premises or on any other part of Property that results by reason of Licensee’s act(s) or Licensee’s permitting certain activities to take place. Acceptability of Insurers All insurance policies shall be issued by California-admitted carriers having current A.M. Best's ratings of no lower than A-:VII. DocuSign Envelope ID: CE4A7329-9609-44E2-8299-7A1EB7B0ECDD Attachment C City of Palo Alto (ID # 12181) City Council Staff Report Report Type: Consent Calendar Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: Second Reading: Ramos Park Park Improvement Ordinance Title: SECOND READING: Adoption of a Park Improvement Ordinance for Renovations at Ramos Park (FIRST READING: March 22, 2021 PASSED 7 -0) From: City Manager Lead Department: Community Serv ices Recommendation Staff recommends the City Council adopt the attached Park Improvement Ordinance for Ramos Park on second reading. As directed by Council on March 22, 2021, the ordinance has been updated since it was first introduced to remove the chain link fence along East Meadow Drive. Background and Discussion On March 22, 2021, the City Council considered an ordinance to approve various improvements to Ramos Park. (See staff report, draft minutes). The Council adopted the ordinance with one change: removal of the proposed 42” tall chain link fence along East Meadow Drive (which was listed in Section 1(d)(5)). The motion as it appears in the draft minutes is: MOTION: Council Member Cormack moved, seconded by Mayor DuBois to adopt the Park Improvement Ordinance for renovation of the playground and park amenities and installation of a restroom at Ramos Park, with the removal of Section D. 5. MOTION PASSED: 7-0 Staff have updated the ordinance accordingly and recommend adopting the ordinance as attached on second reading. Environmental Review This ordinance as recommended is categorically exempt from the provisions of the California Environmental Quality Act (“CEQA”) under CEQA regulations 15301 (Existing Facilities) and 15303 (New Construction of Small Facilities or Structures). Attachments: • Attachment A – Ordinance Approving and Adopting a Plan for Facility Improvements at Ramos Park *NOT YET ADOPTED* 1 215_20210405_ts24 ORDINANCE NO. Ordinance of the Council of the City of Palo Alto Approving and Adopting a Plan for Facility Improvements at Ramos Park The Council of the City of Palo Alto does ORDAIN as follows: SECTION 1. Findings and Improvements. The City Council finds and declares that: (a) Article VIII of the Charter of the City of Palo Alto and section 22.08.005 of the Palo Alto Municipal Code require that, before any substantial building, construction, reconstruction or development is commenced or approved, upon or with respect to any land held by the City for park purposes, the Council shall first cause to be prepared and by ordinance approve and adopt a plan therefor. (b) Ramos Park (the “Park”) is dedicated to park purposes. (See Municipal Code section 22.08.170 et seq.) (c) The City intends to authorize the renovation of various facilities at the Park. (d) The plan of improvements shall comprise as follows: (1) Remove and replace existing toddler playground with a playground spanning the age of toddlers through children age five and above; (2) Installation of a new pre-fabricated restroom building; (3) Expansion of concrete walkway loop path connection; (4) Replace or install site furnishings such as benches, trash receptacles, and drinking fountain; (5) Addition of new basketball court striping and new basketball hoop at the existing paved area; and (6) Planting of native trees and shrubs. (e) Exhibit A depicts the expected implementation of the plan of improvements. (f) The plan of improvements described above is consistent with park, playground, recreation, and conservation purposes. (g) The City Council desires to approve the plan of improvements described above. SECTION 2. The City Council hereby approves the plan of improvements in the Park described in this Ordinance. *NOT YET ADOPTED* 2 215_20210405_ts24 SECTION 3. The City Council finds that this ordinance falls under the California Environmental Quality Act (CEQA) exemptions found in Title 14 California Code of Regulations Section 15301 (Existing Facilities) and Section 15303 (New Construction of Small Facilities or Structures). SECTION 4. This ordinance shall be effective on the thirty-first day after the date of its adoption. INTRODUCED: PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: City Clerk Mayor APPROVED AS TO FORM: APPROVED: Deputy City Attorney City Manager Director of Community Services Director of Public Works *NOT YET ADOPTED* 3 215_20210405_ts24 Exhibit A (see diagram on following page) Exhibit 'A' • E Meadow Dr Native Planting Restroom ripe Existing Paved Area Ramos Park Renovation Exhibit City of Palo Alto (ID # 12061) City Council Staff Report Report Type: Action Items Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: 640 Fairmede: Preliminary Parcel Map with Exceptions Title: PUBLIC HEARING / QUASI -JUDICIAL. 640 Fairmede Avenue [20PLN - 00203]: Request for Council Approval of a Preliminary Parcel Map With Exceptions to Divide an Existing 23,000 Square Foot Parcel Into two Approximately 11,500 Square Foot Lots, Larger Than the Maximum Allowed by the Zoning Code, to Facilitate Construction of two new Single -family Residences. Environmental Assessment: Exempt per CEQA 15303 and 15061(b)(3). Zoning District: R -1 (Single Family Residential) From: City Manager Lead Department: Planning and Development Services Recommendation: Staff recommends that the City Council adopt a Record of Land Use Action (RLUA) approving the request for a Preliminary Parcel Map with Exceptions based on findings and subject to conditions of approval, and as recommended by the Planning and Transportation Commission. Background: The proposed project is to subdivide an existing 23,070 square feet (sf) lot into two lots, one 11,855 sf and the other 11,215 sf. The resulting parcels would be greater than the allowed maximum lot size (9,999 sf) in the R-1 Zoning District. The existing home would subsequently be demolished and replaced with two single-family houses, one on each of the two new parcels. This property is located in the R-1 zoning district in the Palo Alto Orchards neighborhood. Other parcels on the same block range in size from 6,732 sf to 12,868 sf. Excluding the subject property, the average lot size is approximately 10,154 sf. The neighborhood contains one- and two-story, single-family houses. Discussion: City of Palo Alto Page 2 Staff reviewed the proposed project’s consistency with applicable zoning standards ; a summary table is provided as Attachment B. The proposed lots are larger than what is allowed by the Zoning Code, but each lot is in keeping with the average lot size in the area. If approved, the existing house would be demolished and two new houses are expected to be built on the new lots, in a manner that conforms with the Zoning Code. Although the proposed parcels are larger than the allowed maximum lot size, the property is too narrow to create three conforming lots. The total street frontage is 134.04 feet, and the proposal is for two, 67.02-foot wide lots. Divided into three, each lot would only be 44.68 feet wide, whereas a minimum lot width of 60 feet is required. The narrowest lot on the street currently is 70.4 feet wide. The project is consistent with the Comprehensive Plan and the City’s goals to provide more housing units and encourage a consistent neighborhood and streetscape. Consistency with Application Findings Recommending findings to approve the Preliminary Parcel Map with Exceptions is provided in Attachment C. Notably, the proposed project and density is physically suitable for the site and will bring the property into better conformance with the Zoning Code and in a manner consistent with the rest of the neighborhood. The project is expected to provide at least one net new housing unit. The necessary findings for approval of the Preliminary Parcel Map are contained in State law and incorporated into Title 21 of the Municipal Code. Under the Subdivision Map Act, the City Council must make a series of “reverse” findings to justify approval. If the findings cannot be made, the subdivision must be approved. In particular, under government code Section 66474, the City shall deny a Preliminary Parcel Map if any of the findings are made. Otherwise, the City must approve the subdivision. In addition, to approve a map with E xceptions, the City Council must make a series of findings. Planning & Transportation Commission On February 24, 2021 a hearing was held with the Planning & Transportation Commission.1 The Commission discussed the rationale behind creating two oversized lots and the lack of alternative options. The Commission discussed the potential for creating three new parcels that conformed to lot width, depth and area requirements, but one of those parcels would need to be a flag lot with no street frontage other th an an access driveway. Flag lots are restricted in R- 1 zones and the subject parcel is not eligible in accordance with the zoning code. The Commission also discussed the limitations in the zoning code that preclude new cottage courts or other development low density development in R-1 zones. 1 https://www.cityofpaloalto.org/civicax/filebank/documents/80343 City of Palo Alto Page 3 Ultimately, the Planning and Transportation Commission voted 4-0-1 (Roohparvar absent) in the motion to recommend approval of the project. Policy Implications: This project has no major policy implications as the project will bring an oversized lot into greater compliance with the Zoning Code. Staff review ed the proposed project’s consistency with applicable zoning standards, reflected in a summary table (Attachment B). The subject site has a Comprehensive Plan land use designation of Single-Family Residential and is not subject to any Area Plans or Guideline documents. The project is expected to increase the city’s housing stock by at least one unit. Stakeholder Engagement: The PAMC requires notice of this public hearing be published in a local newspaper of general circulation and mailed to owners and occupants of property within 600 feet of the subject property at least ten days in advance of a public hearing. Notice of a public hearing for this project was published in the Daily Post on April 9, 2021, which is 10 days in advance of the meeting. Postcard mailing occurred on April 5, 2021, which is 14 days in advance of the meeting. No public comments were received at the time of report publication. Environmental Review: The subject project has been assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. Specifically, the project is categorically exempt per CEQA Guideline Section 15303 (New Construction or Conversion of Small Structures). Attachments: Attachment A: Location Map (PDF) Attachment B: Zoning Comparison Table (DOCX) Attachment C: Draft Record of Land Use Action (DOCX) Attachment D: Project Plans (DOCX) 167-05-007 167-05-008 167-05-009 167-05-006 167-06-008 167-06-007 167-06-006 167-06-005 167-06-004 167-06-038 167-06-039 167-06-040 3 137-26-062 137-26-061 137-26-059 137-26-060 -26-051 137-26-052 137-26-053 137-26-090 167-06-026 167-06-027 167-06-012 167-06-013 167-06-060 167-06-061 167-06-009 167-06-010 167-06-011 167-06-016 167-06-037 167-06-028 167-06-029 167-06-030 167-06-031 167-06-025 167-06-024 167-06-035 167-06-034 167-06-033 167-06-032 167-06-036 167-06-020 167-06-019 167-06-018 167-06-017 167-06-022 167-06-023 167-06-021 167-07-021 167-07-022 167-07-014 167-07-012 167-07-011 167-07-010 167-07-013 E ARASTRADERO ROAD POMONA AVENUE ARAS L O S P A L O S A V E N U E FAIRMEDE AVENUE LOS PAL OS P CE 4206 4218 4218 4228 4228 4234 38 4277 4267 4267 4257 4257 4280 44256 4 2 5 6 4183 4183 4187 4187 4191 4191 634 634 4190 41904186 4197 4197 4198 4198 645 645 649 649 650 650 653 653 4211 4211 4207 4207 4227 4227 4237 4237 4247 4247 641 641 657 657 651 651 647 647 4244 4244 4248 4248 4217 4217 646 646 640 640639 639 4266 4 2 6 2 4252 4252 4228 4 2 2 8 4234 4 2 3 4 4238 4 2 3 8 4220 4 2 2 0 638 638 632 632 4210 4 2 1 0 4216 4 2 1 6 633 633 627 627 621 621 615 615 611 611 4220 4 2 2 0 4222 4 4 2 3 7 4 2 3 3 4225 4 2 2 5 4217 4 2 1 7 79 4216 4 2 1 6 4213 4 2 1 3 609 4250 4250 This map is a product of the City of Palo Alto GIS This document is a graphic representation only of best available sources. Legend Assessment Parcel Palo Alto Assessment Parcel Palo Alto Assessment Parcel Outside Palo Alto abc Road Centerline Small Text (TC) Curb Face (RF) Pavement Edge (RF) abc Address Label (AP) Current Features 0' 72' Attachment A:640 Fairmede Ave20PLN-00203 CITY O F PALO A L T O I N C O R P O R A T E D C ALIFO R N I A P a l o A l t oT h e C i t y o f A P R IL 1 6 1 8 94 The City of Palo Alto assumes no responsibility for any errors. ©1989 to 2016 City of Palo Alto efoley2, 2021-01-28 09:32:44 Assessor Parcels (\\cc-maps\Encompass\Admin\Meta\View.mdb) ATTACHMENT B ZONING COMPARISON TABLE 640 Fairmede Avenue, 20PLN-00203 Table 1: COMPARISON WITH CHAPTER 18.12 (R-1 DISTRICT) Regulation Required Existing Proposed Parcel 1 Proposed Parcel 2 Minimum/Maximum Site Area 6,000-9,999 sf area 23,070.3 sf Non-conforming: 11,855 sf Non-conforming: 11,215.3 sf Minimum Site Width 6 6 60 feet 134.04 feet wide at front, 154.28 feet wide at rear 67.02 feet wide, additional portion 20 feet wide, 33 feet deep 67.02 feet wide Minimum Site Depth FD 100 feet 167.04 feet 167.04 feet deep 167.04 feet deep Residential Density One unit, except as provided in 18.12.070 One unit One unit One unit (3) R-1 Floodzone Heights: Provided, in a special flood hazard area as defined in Chapter 16.52, the maximum heights are increased by one-half of the increase in elevation required to reach base flood elevation, up to a maximum building height of 33 feet. (6) R-1 Floodzone Daylight Plane: Provided, if the site is in a special flood hazard area and is entitled to an increase in the maximum height, the heights for the daylight planes shall be adjusted by the same amount. Table 2: CONFORMANCE WITH SECTION 18.12.060 and CHAPTER 18.52 (Off-Street Parking) for Single Family Residential Uses Type Required Existing Proposed Parcel 1 Proposed Parcel 2 Vehicle Parking 2 parking spaces per unit, of which one must be covered 2 spaces, one covered for each unit Will comply Will comply 1 ACTION NO. XXXX-XX DRAFT RECORD OF THE COUNCIL OF THE CITY OF PALO ALTO LAND USE ACTION FOR 640 FAIRMEDE AVENUE: PRELIMINARY PARCEL MAP 20PLN-00203 At its meeting on April 19, 2021, the City Council approved the Preliminary Parcel Map for a two-lot subdivision project with exceptions, making the following findings, determinations and declarations: SECTION 1. Background. The City Council of the City of Palo Alto (“City Council”) finds, determines, and declares as follows: A. On September 9, 2020, Mike Ma, on behalf of Catherine Shen, applied for a Preliminary Parcel Map with exceptions for the development of a Two-lot subdivision project (“The Project”). B. The project site is comprised of one lot (APN No. 167-06-025) of approximately 23,070 square feet total. The site contains one residential structure and single- family residential land uses are located adjacent to the lots. SECTION 2. Environmental Review. The subject project has been assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. Specifically, the project is categorically exempt per CEQA Guideline Section 15303 (New Construction of Small Structures). SECTION 3. Preliminary Parcel Map Findings. A legislative body of a city shall deny approval of a Preliminary Parcel Map with Exceptions, if it makes any of the following findings (CGC Section 66474): 1. That the proposed map is not consistent with applicable general and specific plans as specified in Section 65451: The site does not lie within a specific plan area and is consistent with the provisions of the Comprehensive Plan as noted below. 2. That the design or improvement of the proposed subdivision is not consistent with applicable general and specific plans: The map is consistent with the following Comprehensive Plan policies: 2 a. Policy L-1.3: Infill development in the urban service area should be compatible with its surroundings and the overall scale and character of the city to ensure a compact, efficient development pattern. b. Policy L-3.1: Ensure that new or remodeled structures are compatible with the neighborhood and adjacent structures. 3. That the site is not physically suitable for the type of development: The site currently contains one single-family house on a parcel twice the maximum allowed size for R1-zoned properties. The proposed subdivision will create two lots where one exists now resulting in improved compliance with maximum lot standards, but still exceeding in lot area. Each parcel is expected to be developed with single family residences in accordance with applicable zoning regulations. 4. That the site is not physically suitable for the proposed density of development: The proposal for the site will create a residential density closer to th e density in the Zoning Code (one house per 6,000 sf) and closer to the density in the neighborhood (one house per approximately 10,000 sf). 5. That the design of the subdivision or the proposed improvements are likely to cause substantial environmental damage or substantially and avoidably injure fish or wildlife or their habitat: The minor subdivision will not cause environmental damage or injure fish, wildlife, or their habitat. The project site has been fully urbanized and developed and is centrally located within the Palo Alto Orchards neighborhood. There is no recognized sensit ive wildlife or habitat in the project vicinity. 6. That the design of the subdivision or type of improvements is likely to cause serious public health problems: The creation of two individual parcels will not cause serious public health problems, as it does not substantially affect the existing conditions and overall function of the property as a site for single-family residences. 7. That the design of the subdivision or the type of improvements will conflict with easements, acquired by the public at large, for access through or use of, property within the proposed subdivision. In this connection, the governing body may approve a map if it finds that alternate easements, for access or for use, will be provided, and that these will be substantially equivalent to ones previously acquired by the public. This subsection shall apply only to easements of record or to easements established by judgment of a court of competent jurisdiction and no authority is hereby granted to a legislative body to determine t hat the 3 public at large has acquired easements for access through or use of property within the proposed subdivision. The parcel map does not propose nor require any easements. The existing site has no easements. SECTION 5. Exception Findings. The Preliminary Parcel Map with Exceptions also meets the following Findings for the Exceptions (PAMC 21.32.020): 1. There are special circumstances or conditions affecting the property. The existing property is larger than the 10,000 sf maximum allowed by the Zoning Code. The subdivision will bring the property into better conformance with the Zoning Code, although the resulting parcels will continue to exceed 10,000 sf. 2. The exception is necessary for the preservation and enjoyment of a substantial property right of the petitioner. The subject parcel is twice the size of nearby properties and far exceeds the maximum lot standards for R1 zoned properties. The exception request renders the new parcels more compliant with existing zoning standard, results in the creation of at least one additional housing unit and is compatible in design with the surrounding neighborhood. The exception request grants attributes more lot area to each parcel than would otherwise be allowed but is necessary due to the size of the existing parcel and to maintain the complaint lot width and depth requirements for the new parcels. 3. The granting of the exception will not be detrimental to the public welfare or injurious to other property in the territory in which the property is situated. The use of the property will not be detrimental to the public welfare or injurious to other properties in the area, as the proposed use and density is more in conformance with the Code, and similar to other R-1 neighborhoods. 4. The granting of the exception will not violate the requirements, goals, policies, or spirit of the law. Granting this exception is found to be consistent with the Subdivision Map Act, Zoning Code, Comprehensive Plan. It will also provide at least one new housing unit for the City of Palo Alto. 4 SECTION 6. Parcel Map Approval. The Parcel Map submitted for review and approval by the City Council shall be in substantial conformance with the Preliminary Parcel Map prepared by WEC Associates titled “Preliminary Parcel Map”, consisting of five (5) pages, uploaded to Accela Citizen Access on December 4, 2020 except as modified to incorporate the conditions of approval in Section 7. A copy of this plan is on file in the Department of Planning and Development Services. SECTION 7. Conditions of Approval. Planning Division 1. PROJECT PLANS. The Parcel Map submitted for review and approval by the Director shall be in substantial conformance with the Preliminary Parcel Map prepared by WEC “Preliminary Parcel Map”, consisting of 5 pages, dated November 10, 2020, except as modified to incorporate the conditions of this approval. A copy of this plan is on file in the Department of Planning and Community Environment, Current Planning Division. 2. PARCEL MAP COVER PAGE. At such time as the Parcel Map is filed, the cover page shall include the name and title of the Director of Planning and Development Services. 3. PARCEL MAP EXPIRATION. A Parcel Map, in conformance with the approved Preliminary Parcel Map, all requirements of the Subdivision Ordinance (PAMC Section 21.16), and to the satisfaction of the City Engineer, shall be filed with the Planning Division and the Public Works Engineering Division within two (2) years of the Preliminary Parcel Map approval date. The time period for a project may be extended once for an additional year by the Director of Planning if submitted prior to the expiration date. The resultant parcel map must be recorded prior to any building permit issuance. 4. INDEMNITY. To the extent permitted by law, the Applicant shall indemnify and hold harmless the City, its City Council, its officers, employees and agents (the “indemnified parties”) from and against any claim, action, or proceeding brought by a third party against the indemnified parties and the applicant to attack, set aside or void, any permit or approval authorized hereby for the Project, including (without limitation) reimbursing the City for its actual attorneys’ fees and costs incurred in defense of the litigation. The City may, in its sole discretion, elect to defend any such action with attorneys of its own choice. 5. DECONSTRUCTION: The existing structure shall be deconstructed prior to recordation of the Parcel Map, to prevent the existing structure from crossing a property line. 6. ESTIMATED IMPACT FEE: Development Impact Fees, currently estimated in the amount of $73,751.82 plus the applicable public art fee, per PAMC 16.61.040, shall be paid prior to the issuance of the second related building permit. 5 7. IMPACT FEE 90-DAY PROTEST PERIOD. California Government Code Section 66020 provides that a project applicant who desires to protest the fees, dedications, reservations, or other exactions imposed on a development project must initiate the protest at the time the development project is approved or conditionally approved or within ninety (90) days after the date that fees, dedications, reservations or exactions are imposed on the Project. Additionally, procedural requirements for protesting these development fees, dedications, reservations and exactions are set forth in Government Code Section 66020. IF YOU FAIL TO INITIATE A PROTEST WITHIN THE 90-DAY PERIOD OR FOLLOW THE PROTEST PROCEDURES DESCRIBED IN GOVERNMENT CODE SECTION 66020, YOU WILL BE BARRED FROM CHALLENGING THE VALIDITY OR REASONABLENESS OF THE FEES, DEDICATIONS, RESERVATIONS, AND EXACTIONS. If these requirements constitute fees, taxes, assessments, dedications, reservations, or other exactions as specified in Government Code Sections 66020(a) or 66021, this is to provide notification that, as of the date of this notice, the 90-day period has begun in which you may protest these requirements. This matter is subject to the California Code of Civil Procedures (CCP) Section 1094.5; the time by which judicial review must be sought is governed by CCP Section 1094.6. Public Works Engineering 8. The City Engineer Statement shall read as follows: I HEREBY STATE THAT I HAVE EXAMINED THE WITHIN MAP; THAT ALL THE PROVISIONS OF THE SUBDIVISION MAP ACT AND ANY LOCAL ORDINANCE APPLICABLE AT THE TIME OF THE APPROVAL OF THE PRELIMINARY PARCEL MAP HAVE BEEN COMPLETED. THE SUBDIVISION AS SHOWN IS SUBSTANTIALLY THE SAME AS IT APPEARED ON THE PRELIMINARY PARCEL MAP AND ANY APPROVED ALTERATIONS THEREOF. 9. Provide the Closure Calculations for review. 10. Provide electronic copies of the referenced documents, parcel map and preliminary title report. Utilities PRIOR TO ISSUANCE OF DEMOLITION PERMIT 11. The applicant shall submit a request to disconnect utility services and remove me ters. The utilities demo to be processed within 10 working days after receipt of request. The demolition permit will be issued by the building inspection division after all utility services and/or meters have been disconnected and removed. FOR BUILDING PERMIT 6 12. The applicant shall submit a completed water-gas-wastewater service connection application - load sheet for City of Palo Alto Utilities. The applicant must provide all the information requested for utility service demands (water in fixture units/g.p.m., gas in b.t.u.p.h, and sewer in fixture units/g.p.d.). The applicant shall provide the existing (prior) loads, the new loads, and the combined/total loads (the new loads plus any existing loads to remain). 13. The applicant shall submit improvement plans for utility construction. The plans must show the size and location of all underground utilities within the development and the public right of way including meters, backflow preventers, fire service requirements, sewer mains, sewer cleanouts, sewer lift stations and any other required utilities. Plans for new wastewater laterals and mains need to include new wastewater pipe profiles showing existing potentially conflicting utilities especially storm drain pipes, electric and communication duct banks. Existing duct banks need to be daylighted by potholing to the bottom of the ductbank to verify cross section prior to plan approval and starting lateral installation. Plans for new storm drain mains and laterals need to include profiles showing existing potential conflicts with sewer, water and gas. 14. The applicant must show on the site plan the existence of any auxiliary water supply, (i.e. water well, gray water, recycled water, rain catchment, water storage tank, etc). 15. The applicant shall be responsible for installing and upgrading the existing utility mains and/or services as necessary to handle anticipated peak loads. This responsibility includes all costs associated with the design and construction for the installation/upgrade of the utility mains and/or services. 16. An approved reduced pressure principle assembly (RPPA backflow preventer device) is required for all existing and new water connections from Palo Alto Utilities to comply with requirements of California administrative code, title 17, sections 7583 through 7605 inclusive. The RPPA shall be installed on the owner's property and directly behind the water meter within 5 feet of the property line. RPPA’s for domestic service shall be lead free. Show the location of the RPPA on the plans. 17. All backflow preventer devices shall be approved by the WGW engineering division. Inspection by the city inspector is required for the supply pipe between the meter and the assembly. 18. The applicant shall pay the capacity fees and connection fees associated wi th new utility service/s or added demand on existing services. The approved relocation of services, meters, hydrants, or other facilities will be performed at the cost of the person/entity requesting the relocation. 7 19. If a new water service line installation for fire system usage is required. Show the location of the new water service on the plans. The applicant shall provide to the engineering department a copy of the plans for fire system including all fire department's requirements. 20. Each unit or place of business shall have its own water and gas meter shown on the plans. Each parcel shall have its own water service, gas service and sewer lateral connection shown on the plans. 21. A new gas service line installation is required. Show the new gas meter location on the plans. The gas meter location must conform to utilities standard details. 22. A sewer lateral per lot is required. Show the location of the new sewer lateral on the plans. A profile of the sewer lateral is required showing any possible conflicts with storm, electric/communications ductbanks or other utilities. 23. All existing water and wastewater services that will not be reused shall be abandoned at the main per WGW utilities procedures. 24. Utility vaults, transformers, utility cabinets, concrete bases, or other structures cannot be placed over existing water, gas or wastewater mains/services. Maintain 1’ horizontal clear separation from the vault/cabinet/concrete base to existing utilities as found in the field. If there is a conflict with existing utilities, Cabinets/vaults/bases shall be relocated from the plan location as needed to meet field conditions. Trees may not be planted within 10 feet of existing water, gas or wastewater mains/services or meters. New water, gas or wastewater services/meters may not be installed within 10’ or existing trees. Maintain 10’ between new trees and new water, gas and wastewater services/mains/meters. 25. To install new gas service by directional boring, the applicant is required to have a sewer cleanout at the front of the building. This cleanout is required so the sewer lateral can be videoed for verification of no damage after the gas service is installed by directional boring. 26. The applicant shall secure a public utilities easement for facilities installed in private property. The applicant's engineer shall obtain, prepare, record with the county of Santa Clara, and provide the utilities engineering section with copies of the public utilities easement across the adjacent parcels as is necessary to serve the development. 27. All utility installations shall be in accordance with the City of Palo Alto utility standards for water, gas & wastewater. 8 SECTION 8. Term of Approval. 1. Preliminary Parcel Map. All conditions of approval of the Preliminary Parcel Map shall be fulfilled prior to approval of a Parcel Map (PAMC Section 21.16.010[c]). Unless a Parcel Map is filed, and all conditions of approval are fulfilled within a two -year period from the date of Preliminary Parcel Map approval, or such extension as may be granted, the Preliminary Parcel Map shall expire and all proceedings shall terminate. The Director of Planning and Development Services may approve one extension prior to expiration of the Preliminary Parcel Map, consistent with the provisions of PAMC Title 21. PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: APPROVED: _________________________ ____________________________ City Clerk Director of Planning and Development Services APPROVED AS TO FORM: ___________________________ Senior Asst. City Attorney PLANS AND DRAWINGS REFERENCED: Those plans prepared by WEC Associates titled “Preliminary Parcel Map”, consisting of five pages, dated December 4, 2020. Attachment D Project Plans During Shelter-in-Place, project plans are only available online. Directions to review Project plans online: 1. Go to: bit.ly/PApendingprojects 2. Scroll down to find “640 Fairmede” and click the address link 3. On this project specific webpage you will find a link to the project plans and other important information Direct Link to Project Webpage: https://www.cityofpaloalto.org/news/displaynews.asp?NewsID=5097&TargetID=319 City of Palo Alto (ID # 12009) City Council Staff Report Report Type: Action Items Meeting Date: 4/19/2021 City of Palo Alto Page 1 Council Priority: Climate/Sustainability and Climate Action Plan, Transportation and Traffic Summary Title: S/CAP Report Title: City Council Review of the Sustainability and Climate Action Plan (S/CAP) Update Report, Provide Feedback on Policy Tools, and D irection to Staff to Implement an S/CAP Engagement Strategy for three S/CAP engagement tracks that includes outreach to Council, Commissions, and the community. From: City Manager Lead Department: Public Works Recommendation Staff recommends that City Council 1. Discuss and provide feedback to staff on policy tools that could be implemented in S/CAP analysis (Attachment A) that would be included in the S/CAP engagement strategy for further refinement and eventual adoption of a revised Sustainability and Climate Action Plan, and 2. Provide direction on stakeholder engagement for the Sustainability and Climate Action Plan (S/CAP) Update, and direct staff to develop and implement an S/CAP engagement strategy for S/CAP engagement tracks that includes outreach City Board, Commissions and Committees, key stakeholders, and the community at large. Executive Summary Consistent with Council’s adoption of “Climate Change – Protection and Adaptation” as one of the four priorities for calendar year 2021, staff is developing a 2021 Sustainability and Climate Action Plan (S/CAP) to help the City meet its sustainability goals, including its goal of reducing greenhouse gas (GHG) emissions 80 percent below 1990 levels by 2030 (the “80 x 30” goal). Staff presented the Major Goals and Key Actions related to greenhouse gas emissions reduction1 to Council on June 16, 2020. Amidst the backdrop of a global pandemic, an economic downturn, and other challenging events, Council directed staff to continue with its work on 1 https://www.cityofpaloalto.org/civicax/filebank/blobdload.aspx?t=59513.75&BlobID=77028 CITY OF PALO ALTO City of Palo Alto Page 2 finding strategies to achieve the 80 x 30 goal. Staff has devoted extensive analytical and research efforts to estimating the GHG reduction potential of proposed strategies, estimated costs, and additional sustainability co-benefits (such as improved local air quality or reduced cost of living). The status of the 2021 S/CAP was detailed at the February 3, 2021 Utilities Advisory Commission Meeting2 and the February 22, 2021 Council Meeting3. While extensive discussion of the preliminary results of the S/CAP impact analysis is presented in this report, staff’s primary goal with this report is to request Council’s - feedback to staff on examples of policy tools that could be implemented in S/CAP analysis (Attachment A), and - direction on next steps for reviewing this information with the Council, Commissions, and the community, leading to stakeholder engagement and adoption of a revised S/CAP Essentially, staff’s analysis and preliminary results reflect one scenario for achieving the 80 x 30 goal. While this scenario represents staff’s best professional judgement, it is important to vet this analysis through community review and feedback. Many of these proposals and financing measures represent novel applications of local government authority. As such, another key component is additional in-depth legal analysis as staff develops more detail about individual program proposals. Staff has included community engagement options as part of this report. Details of the preliminary impact analysis are included in this report in Attachment B. A recorded webinar providing an overview can be found at this link4. In parallel with the S/CAP process, staff is working on development of the Sea Lev el Rise Adaptation Policy. Engagement around S/CAP development and sea level rise will be closely coordinated. AECOM, the City’s consultant, has prepared a 2019 greenhouse gas (GHG) emissions inventory. Palo Alto's 2019 emissions were roughly 482,000 metric tons, approximately 38.2 percent below 1990 emissions (which were about 780,000 metric tons). Of that 38.2 percent reduction to-date, 24 percent came from achieving carbon neutrality for the City’s electricity portfolio, and the remaining 14 percent reductions were due to declines in the City’s natural gas emissions, transportation emissions, and emissions from other sources. Of the remaining emissions sources as of 2019, roughly 61 percent are from on-road transportation, 32 percent are from natural gas use, and the remainder are from other sources. AECOM has also prepared a forecast of emissions under “business as usual” (BAU) conditions to show how much GHG reduction will be achieved if the City only implements policies and plans that Council has already adopted and follows California-wide goals and regulations. AECOM’s BAU Forecast showed emissions at 47.4 percent below 1990 levels in 2030 and 49.4 percent 2 https://www.cityofpaloalto.org/civicax/filebank/documents/80035 3 https://www.cityofpaloalto.org/civicax/filebank/documents/80219 4 https://www.youtube.com/playlist?list=PLJ0x6PDuVXlPJ2o1qIlEXINb8rQ8HNMid City of Palo Alto Page 3 below 1990 levels in 2040 without additional City actions. Staff adjusted the AECOM BAU forecast to account for higher expected EV adoption for Palo Alto due to the Governor’s recent executive order setting a goal of eliminating new gasoline vehicle sales in California by 2035, as well as post-pandemic telecommuting trends. The Adjusted BAU Forecast predicts emissions at 52.1 percent below 1990 levels in 2030 and 59.6 percent below 1990 levels in 2040 without additional City actions. In addition, staff has completed the preliminary Impact Analysis. In order to meet its 80 x 30 goal, the City will need to decide on a policy framework that takes into account updated climate science describing what actions are needed to combat global warming, and reinforce community awareness leading to actions that aggressively reduce vehicle miles traveled and vehicle emissions, and electrify existing buildings. The overall scenario described in staff’s preliminary analysis achieves 72 percent reduction below 1990 levels by 2030, leaving 8 percent remaining. The analysis also identifies a number of policies that could be pursued, if legally feasible, while continuing analysis to identify the remaining 8 percent needed. Based on staff and consultant modeling, and depending on what strategies Council cho oses to pursue, the cost to implement the goals and key actions analyzed is roughly $740 million. If debt financing is available5, staff estimated the annual cost in 2030 would be roughly $53 million per year. Fortunately, there are ongoing savings associated with these emissions reductions6 estimated at $43 million per year, for a net cost of $10 million per year. For comparison, the total of all community electric and gas bills is roughly $175 million per year. This means the net cost to implement would be 5 percent to 6 percent of total community energy spending. The actual costs and benefits accrue differently across the community, however. Section 4.b. of Attachment B discusses this issue and potential solutions. While the costs may seem high and the scale of action large, the cost of inaction is also high. Section 4.c. of Attachment B discusses the potential impacts of slowing achievement of the goals. Background In April 2016, City Council adopted the ambitious goal of reducing GHG emissions to 80 percent below 1990 levels by 20307 (the “80 x 30” goal) - 20 years ahead of the State of California 80 x 50 target, and an interim step towards California’s new statewide goal of achieving carbon neutrality by 20458. In November 2016 the Council adopted the S/CAP Framework9, which has served as the road map for achieving Palo Alto’s sustainability goals. In December 2017, Council 5 Staff assumed financing over the life of each electrified appliance at municipal bond rates for the purposes of this analysis. 6 Savings in vehicle fuel, vehicle maintenance, and decreased natural gas bills net of increased electric bills. 7 https://www.cityofpaloalto.org/news/displaynews.asp?NewsID=3534&TargetID=268 8 In September 2018, Governor Brown signed California Executive Order B-55-18, setting the goal of achieving carbon neutrality as soon as possible, and no later than 2045. The state is to maintain net negative net emissions after 2045, meaning that GHG sinks must exceed GHG sources. The Executive Order explains that the carbon neutrality goal is layered on top of the state’s existing commitments to reduce greenhouse gas emissions 40% below 1990 levels by 2030 (as codified in SB 32), and 80% below 1990 levels by 2050. 9 https://www.cityofpaloalto.org/civicax/filebank/documents/60858 City of Palo Alto Page 4 accepted the 2018-2020 Sustainability Implementation Plan “Key Actions” as a summary of the City’s work program10. In early 2020, the City launched an S/CAP update to determine the goals and key actions needed to meet its sustainability goals, including the 80 x 30 goal. While GHG emissions reduction is not the only goal of the S/CAP, it is the major one. Over the next nine years, if the City only implements City Council approved plans, policies, and ordinances that were approved on or before 2019, and considering demographic changes, Palo Alto’s emissions are projected to be 47.4 percent below 1990 levels in 2030 (410,435 MTCO2e) – a “business-as-usual” (BAU) scenario. To achieve the 80 x 30 goal, Palo Alto must meet a GHG emissions target of 156,024 MT CO2e. Palo Alto will need to reduce total emissions by about 326,303 MT CO 2e, or an additional 254,411 MT CO2e beyond “Business-as-usual” projections, at a rate of 3.8 percent per year, significantly increasing the scale and speed of reductions. As a result of various City-led initiatives, programs, and activities focused on climate change and sustainability, by the end of 2019 Palo Alto reduced GHG emissions an estimated 38.2 percent from the 1990 baseline, despite a population increase of 23.6 percent during that same time period. Discussion The City is fully committed to a sustainable future. The City owns, operates, and maintains a full-service utilities portfolio that provides electric, natural gas, water and wastewater services to residents and businesses in Palo Alto. Palo Alto’s continued leadership in advancing sustainability commitments has succeeded mainly because of the continued co llaboration of community stakeholders, City departments and the leadership of the City Council. Consistent with Council’s adoption of “Climate Change – Protection and Adaptation” as one of the four priorities for CY 2021, staff has prepared a 2019 greenhouse gas (GHG) emissions inventory and a Business as Usual (BAU) Forecast to show how much GHG reduction will be achieved if the City only implements policies and plans that Council has already adopted and follow California-wide goals and regulations. In addition, staff, with technical assistance from AECOM, has completed the preliminary Impact Analysis. In order to meet the 80 x 30 goal, the City will need to decide on a policy framework that takes into account updated climate science describing what actions are needed to combat global warming, and reinforce community awareness leading to actions that aggressively reduce vehicle miles traveled and vehicle emissions, and electrify existing buildings. AECOM has reviewed the preliminary Impact Analysis and is drafting a memo that includ es a summary of the results of the preliminary Impact Analysis, their assessment of the modeling work, and recommendations for next steps. AECOM’s review of the preliminary Impact Analysis is not part of this report and will be shared at a future council meeting. 10 https://www.cityofpaloalto.org/civicax/filebank/documents/63141 City of Palo Alto Page 5 This staff report includes a potential list of policy tools that could be implemented as part of the SCAP adoption to further the City’s 80x30 goals, a summary of the 2019 GHG inventory and the changes from previous inventories, the Business as Usual forecast and an adjusted Business as Usual forecast, the preliminary Impact analysis, and a financial analysis and community and stakeholder options for the Council to consider. A potential list of shorter term, near term and longer term policy tools can be found in Attachment A. The full Sustainability and Climate Action Plan update report with detailed analysis can be found in Attachment B. Policy Tools and Actions to Consider As Part of SCAP Development Attachment A lists a variety of preliminary proposed measures which involve different levels of government intervention and community programs designed to make it easy for early adopters to electrify. Low intervention policy tools include outreach efforts or voluntary programs. Medium intervention actions could include ordinances requiring electrification of appliances at end of life and low-level carbon pricing. Higher intervention actions include mandating electrification by a date certain or imposing carbon pricing on private property, and other actions which could present legal challenges and/or where the City must either comply with or secure changes to state and federal laws that would otherwise constrain some promising approaches. Local community support and voter approval may be an important ne xt step on several of these actions. Direct advocacy at the state level, for some if not all of the medium and high intervention actions, may also be necessary. Staff expects that high-intervention, mandatory actions will be needed to achieve the outcomes required to achieve the city’s 80 x 30 goals. With that said, the outreach efforts and voluntary programs can make a big difference in conjunction with other city actions. Direct local community action will be needed to make a global impact on sustainability at the local level and move us further towards the city’s 80x30 vision. The final recommendations contained in the revised SCAP for Council consideration will include a series of low, medium and high interventions to help the city achieve its 80x30 goals and much of the community and stakeholder engagement planned will involve gaining further input on these and other items to inform Council consideration and eventual adoption of the revised SCAP later in 2021. It would be helpful for staff to hear fro m Council on the potential low, medium or high interventions. Some examples of potential actions include: Voluntary and outreach programs that could have a short-term impact include: • Expand electrification incentives to cover space heating and cooking equipment for residential and nonresidential customers • Expand program services targeting multi-family buildings and low-income households to include electrification projects • Expand program services to non-residential facilities to electrify water and space heating system • Targeted outreach to multifamily residential (MFR) and lower income residents, including assistance with charger installation for MFR buildings. • Continue to provide rebates and technical assistance for workplace charging. City of Palo Alto Page 6 Mid-term actions could include: • Launch direct-install program for EV charging with on-bill financing • Allocate funding for charger installation for low income residents • Mandate non-residential new construction projects to meet all-electric requirements ideally via Reach Code • Adopt mandate to require end-of-life replacement of mixed-fuel rooftop packaged HVAC systems with electric heat pump systems starting in 2023 • Launch direct-install program for EV charging with on-bill financing • Allocate funding for charger installation for low income residents • Residential EV credit – electric bill discount for registered EVs • Institute project to build 30 miles of Bicycle Boulevard /Traffic Calming facilities over next 20 years • Explore ballot measures to further infrastructure focused on impacts to the City’s sustainability goals • Traffic signal related equipment improvement to improve traffic flow, reducing idling time and associated GHG emissions For the full list of potential actions for further Council input, see Attachment A. Summary of the Sustainability and Climate Action Plan Update Report The attached Sustainability and Climate Action Plan update report is organized by a series of sections that provide greater depth and information on several elements of the 2019 GHG inventory and other analysis. The following summary is a high-level overview of the details contained in Attachment B. Palo Alto’s 2019 Greenhouse Gas Emissions Inventory - Cities represent the single greatest opportunity for tackling climate change, as they are responsible for more than 70 percent of global energy-related carbon dioxide emissions. The first step for cities to realize their potential is to identify and measure where their emissions come from. In 2019, Palo Alto emitted an estimated 482,327 metric tons (MT) of carbon dioxide equivalent (CO2e) from the residential, commercial, industrial, transportation, waste, water, and municipal sectors.11 In comparison to the 1990 base year, that is a 38.2 percent decrease in total community emissions, despite a population increase of 23.6 percent during that same time period. Of that 38.2 percent reduction to-date, 24 percent came from achieving carbon neutrality for the City’s electricity portfolio, and the remaining 14 percent reductions were due to declines in the City’s natural gas emissions, transportation emissions, and emissions from other sources. Of the remaining emissions sources as of 2019, roughly 61 percent are from on-road transportation, 32 percent are from natural gas use, and the remainder are from ot her sources. The full comparison between the 1990 and 2019 GHG inventories can be found in Attachment C: 1990 vs. 2019 Greenhouse Gas Emissions by Sector and Subsector. 11 Carbon dioxide equivalent is a unit of measure that normalizes the varying climate warming potencies of all six GHG emissions, which are carbon dioxide (CO2), methane (CH4), nitrous oxide (N2O), hydrofluorocarbons (HFCs), perfluorocarbons (PFCs), and sulfur hexafluoride (SF 6). For example, one metric ton of nitrous oxide is 210 metric tons of CO2e. City of Palo Alto Page 7 Figure 1: 1990 vs 2019 GHG Emissions by Sector Business As Usual (BAU) Forecast - AECOM developed a forecast of future emissions to understand what reduction measures are needed to meet the 80 x 30 goal. This BAU projection represents the emissions expected if the 2019 patterns of travel, energy and water consumption, and waste generation/disposal persist. It includes emissions reductions as a result of implementation of all the City Council approved plans, policies, and ordinances that were approved on or before 2019. This projection factors in the expected rate of county population and job growth and is considered in the absence of any statewide measures, policies, or actions that would reduce emissions, including state legislation and/or any other policies or procedures adopted after 2019. Under a BAU scenario, Palo Alto emissions are projected to be 47.4 percent below 1990 levels in 2030 (410,435 MT CO2e) and 49.4 percent below 1990 levels in 2040 (394,451 MT CO2e). The BAU forecast developed by AECOM is based on 2019 trends, and therefore leaves out the impacts of the COVID-19 pandemic and the increase in remote work as well as the market shifts from Governor Newsom’s September 2020 Executive Order N-79-20, which directs California to require that, by 2035, all new cars and passenger trucks sold in the state b e zero-emission vehicles. Staff adjusted AECOM’s BAU forecast to include these factors, using data and assumptions specific to Palo Alto. Assuming that 50 percent of employees are eligible for remote work and that (if supported by city policies and program s) they opt for 2 days a week of remote work, then commute Vehicle Miles Traveled (VMT) could be reduced by 8 percent to 11 percent12 compared to 2019 levels. On-road transportation emissions in the 2030 BAU forecast 12 While permanent increases in work-from-home behavior will lead to decreased commute VMT, this reduction is off-set by additional travel for non-commute reasons, such as increased VMT from driving to run errands and Palo Alto Citywide Greenhouse Gas Emissions by Sector 900,000 ■ Brown Power Supply 800,000 (Electricity) Cl) ■ Solid Waste 0 u 700,000 ._ 0 I-600,000 ■ Wastewater ~ "' 500,000 C 0 ■ Natural Gas Fugitive ·;;; "' .E 400,000 Emissions LU ■ Natural Gas Use I!) 300,000 ::c I!) 200,000 ■ Additional Transportation 100,000 Sources 0 ■ On-Road Transportation 1990 2019 City of Palo Alto Page 8 could be reduced an additional 3.8 percent from remote work. This translates into a 3 percent reduction in on-road transportation emissions relative to 2019 levels, or a 2.8 percent reduction of on-road transportation emissions relative to 1990 levels and slightly more than 1 percent of total 1990 emissions. In addition, Palo Alto currently has one of the highest electric vehicle (EV) adoption rates in the country. The models used to calculate AECOM’s BAU forecast do not include Palo Alto specific EV adoption rates – they use Santa Clara County EV adoption rates. For EVs, market share is projected to increase from the current 30% to 50% in 2030, based on a CA-specific EV sales forecast13. Assuming that 31 percent of all Palo Alto registered vehicles will be EVs by 2030 without additional City action, on-road transportation emissions in the 2030 BAU forecast could be reduced an additional 11.3 percent through EV adoption. This translates into a 9 percent reduction of on-road transportation emissions relative to 2019 levels or an 8 percent reduction of on-road transportation emissions relative to 1990 levels and 4 percent of total 1990 emissions. Under staff’s adjusted BAU scenario, Palo Alto emissions are projected to be 52.1 percent below 1990 levels in 2030 (373,769 MTCO2e) and 59.6 percent below 1990 levels in 2040 (314,968 MTCO2e). Figure 2: Adjusted “Business as Usual” GHG Emissions Projection and Reduction Target getting more deliveries at home. Studies show that the degree of this added non-commute VMT ranges from 15% of the total saved, to more than 100% of the total saved. 13 UBS Investment Bank, March 2021. “EVs Shifting into Overdrive: How will electric cars re -shape the auto industry?”. https://neo.ubs.com/static/login.html?origin=/shared/d24IiDrju8G4f 217,745 MT CO2e ~36,666 MT CO2e 900,000 800,000 700,000 600,000 500,000 400,000 300,000 200,000 100,000 0 1990 2005 2013 2019 2030 2040 -Actual Emissions -BAU Em issions Forecast -Adjusted BAU Emissions Forecast -80 x 30 Target City of Palo Alto Page 9 Impact Analysis – Staff and AECOM modeled the outcomes needed to achieve the 80 x 30 goal, keeping in mind updated climate science and the global impacts of climate change, as well as the increased community awareness needed. While there are multiple strategies to reduce Palo Alto’s emissions, the scenario described below represents the most technically feasible and cost-effective pathway staff and its consultant could identify. While legal analysis of these preliminary measures is underway, additional in-depth review will be needed as implementation details emerge. The full details of the preliminary Impact Analysis can be found in Attachment B, Section 4, and the Supplemental Charts can be found in Attachment D. Staff and AECOM have identified the following outcomes in 2030 as necessary to achieve the 80 percent reduction: • Commute travel is reduced 10 percent via telecommuting • Vehicle Miles Traveled (VMT) are reduced 8 to 11 percent • 85 percent of all Palo Alto new vehicle purchases are EVs, up from 30 percent now, which results in a vehicle fleet that is 44 percent EVs (50 percent in single-family households, 33 percent in multi-family) • 40 percent of commuter trips into Palo Alto and 30 percent of visitor trips are made in EVs (35 percent overall). This is up from 3 percent right now. • Virtually all single-family gas appliances and virtually all commercial rooftop HVAC units are electrified • Significant additional multi-family and commercial building electrification and other emissions reductions to be determined • An additional 65,0000 MT CO2e of emissions reductions are achieved through other measures. Staff’s preliminary analysis only achieves 72 percent reductions below 1990 levels, leaving an 8% gap to be closed. More detail on the key actions modeled to achieve the above outcomes can be found in Attachment A. Based on staff and consultant modeling, and depending on what strate gies Council chooses to pursue, staff estimates the total cost to implement the goals and key actions analyzed is roughly $740 million in 2021 dollars (note that there would be an additional cost to achieving the remaining 8% GHG emissions reductions, but this cost is unknown at this time). This investment would take place through 2030. This is the up-front capital cost for the necessary vehicle and mobility investments, investments in charging infrastructure, and investments in appliances and building infrastructure. It includes utility improvements needed to support the transformation. It does not include operational savings to customers from eliminating natural gas bills, gasoline expenditures, and the value of reduced vehicle maintenance. If debt financing is available14, staff estimated the annual cost in 2030 would be roughly $53 million per year. 14 Staff assumed financing over the life of each electrified appliance at municipal bond rates for the purposes of this analysis. City of Palo Alto Page 10 There are also significant annual operational savings to customers from these measures. These annual operational savings are expected to be roughly $43 million per year in 2030, for a net cost of $10 million per year. For comparison, the total of all community electric and gas bills is roughly $175 million per year. This means the net cost to implement would be 5 percent to 6 percent of total community energy spending. The actual costs and benefits accrue differently across the community, however. Section 4.b. of Attachment B discusses this issue and potential solutions. By 2033, benefits are estimated to match costs and from then forward electrification would represent a net benefit to the community as a whole. This means achieving the S/CAP goals would likely result in lower household and business expenses throughout the community in the long term, which could make residents and businesses open to funding othe r community investments such as undergrounding utilities or fiber to the home. While the costs may seem high and the scale of action needed may seem large, the cost of inaction is also high. The analysis of the estimated costs to achieve 80 x 30 and the cost of delaying action can be found in Attachment B, Section 4.b. and 4.c. Council and Stakeholder Engagement Staff developed, and is implementing, a 2021 S/CAP Engagement Plan which identifies relevant stakeholders, proposed materials, and desired meeting milestones and outcomes. Key steps to date have been a March 31 – April 14, 2020 Community Engagement Virtual Workshop; Council Study Sessions on April 13, 2020 and June 16, 2020; a Utilities Advisory Commission Study Session on May 20, 2020; June 2020 Study sessions with the Utilities Advisory Commission, Planning and Transportation Commission, and Parks and Recreation Commission; and a Fall 2020 S/CAP Webinar series to highlight various topics addressed in the 2021 S/CAP. Topics covered in the Fall 2020 S/CAP Webinar series included: an overview of the Sustainability and Climate Action Plan, Sea Level Rise, All-Electric Homes, Transportation, and the Natural Environment. The webinar recordings, PowerPoint presentations, and questions and answers can be found on the S/CAP Website15. The webinars were generally well received, with an average of 90 participants at each webinar. Many participants responded to the webinar surveys. The following are some examples of ideas supported by survey respondents: • Further exploration of a carbon fund, carbon “savings account”, or vehicle miles travelled (VMT) bank to reduce greenhouse gas emissions • A ballot measure at some point in the future that raises funds from the community in order to reduce greenhouse gas emissions • Rebates for electric panel upgrade and electric conduit installation, and a special electric rate for all-electric homes • A special electricity rate for EVs that would help their decision to switch to an EV • Participants indicated that working from home; better access, efficiency, and reliability of public transit; closer proximity to amenities (e.g. grocery stores); and safer bike routes would motivate them to drive less. 15 https://www.cityofpaloalto.org/services/sustainability/sustainability_and_climate_action_plan/community_engag ement/default.asp City of Palo Alto Page 11 For the next phase of S/CAP development, staff proposes focusing on three themes of work that would proceed concurrently: 1. Technical Analysis: Climate action technical analysis review and comments, including legal review of key actions as details become available 2. Policy Development: Review and feedback on S/CAP climate policies analyzed 3. Near-Term Programs: Development of proposals for programs to be implemented in 2021 to 2024 An additional body of work involves outreach and engagement, which while necessarily integrated with the tracks above, could be considered a discrete effort with specific stakeholders, strategies, and tactics. In either case, outreach and engagement would be an aspect of all three tracks above including technical analysis, policy development, and near-term programs. Recommended options for Council consideration include: Council Involvement Options 1. Continue to bring items directly to the City Council 2. Create an Ad Hoc Committee to assist staff as work is underway 3. Provide status reports on S/CAP work to the Finance Committee (acknowledging the technical analysis and costs the overall S/CAP elements will require) Community Engagement Options 1. Utilize City’s Board, Commission and Committee (BCC) Structure. Staff is recommending using the City’s existing Boards, Commission and Committee structure to gain input on specific topic areas that the BCC’s focus on including: • Utilities Advisory Commission o Technical Analysis – Energy (Building Electrification), Mobility, EVs o Policy Development – Energy (Building Electrification), Mobility, EVs, Climate Adaptation and Sea Level Rise o Near-Term Programs – Energy (Building Electrification), Mobility, EVs • Planning and Transportation Commission o Technical Analysis - Mobility, EVs o Policy Development - Mobility, EVs, Climate Adaptation and Sea Level Rise o Near-Term Programs - Mobility, EVs • Parks and Recreation Commission o Policy Development - Water, Climate Adaptation and Sea Level Rise, Natural Environment, Zero Waste o Near-Term Programs - Water, Climate Adaptation and Sea Level Rise, Natural Environment, Zero Waste • Human Relations Commission o Policies with provisions for income-qualified residents 2. Industry-Specific Roundtable discussions. These engagement opportunities will provide initial input on technical analysis, policy development, and near-term programs by City of Palo Alto Page 12 bringing together industry specific stakeholders and advocates . These smaller group sessions will help inform and gain input as further work is completed. 3. Community Meetings. As work is further developed in these three focus areas, staff could use community meetings as a venue to continue engage several stakeholder groups and community members on milestones in the work, provide progress updates and gain input as recommendation are being finalized. 4. Online Survey. Staff plans to use an online survey or surveys to gain input from a broad range of the community when the draft S/CAP recommendations are finalized to help inform Council consideration/adoption. 5. Community Summit Series. A series of summits by distinct topic areas will be used to share final draft recommendations before Council adoption. The summits will be split into topic areas including: Energy; Mobility/EV; Sea Level Rise; and Water, Natural Environment, and Zero Waste. As noted above, staff is working on development of the Sea Level Rise Adaptation Policy in parallel with the S/CAP. In addition to S/CAP engagement options above, staff continues to develop community engagement planning specific to sea level rise. The next public meeting for the Sea Level Rise Adaptation Policy is scheduled for May 202116. Timeline The timeline is dependent upon Council’s approval of council governance and community engagement. If Council approves the community engagement options above, the following would be a general timeline of staff work ahead: • May: Sea Level Rise Adaptation Policy Public Meeting • June-August: Industry specific Roundtable Discussions on S/CAP tracks • Early Fall 2021: Commission meetings on the S/CAP tracks, potential select community meetings • Early Winter 2021: Online survey and Summit Series • December 2021: Final Draft S/CAP presented to Council for adoption • Spring 2022: California Environmental Quality Act (CEQA) evaluation completed • Spring 2022: S/CAP with CEQA Review presented to Council for approval Policy Implications The Sustainability and Climate Action Plan Update Report aligns with one of the top four Council Priorities for CY 2021: “Climate Change – Protection and Adaptation” Resource Impact Initiatives are across departments and funds. Some are funded in current budgets, others will be recommended as part of the FY 2022 Proposed Budget, while most will need to be prioritized in consideration of competing priorities. Unfortunately, this significant comes at a 16 More information about the Sea Level Rise Adaptation Policy process can be found at http://cityofpaloalto.org/sealevelrise. City of Palo Alto Page 13 time of an acute awareness of resource limitations associated with pandemic recovery. Environmental Review Council’s review of this report is not a project under Section 21065 for purposes of the California Environmental Quality Act (CEQA). The final 2021 S/CAP will be evaluated consistent with CEQA prior to approval by the City. Attachments: • Attachment A: Examples of Policy Tools That Could be Implemented in S/CAP Analysis, by Year • Attachment B: Sustainability and Climate Action Plan Update Report • Attachment C: 1990 vs 2019 GHG Emissions by Sector and Subsector • Attachment D: Supplemental Charts and Tables Attachment A: Examples of Policy Tools That Could be Implemented in S/CAP Analysis, by Year This table shows a variety of preliminary proposed measures which involve different levels of government intervention. Low intervention policy tools include outreach efforts or voluntary programs designed to make it easy for early adopters to electrify. Medium intervention actions include ordinances requiring electrification of appliances at end of life and low- level carbon pricing. Higher intervention actions include mandating electrification by a date certain or imposing carbon pricing on private property. Staff expects that high-intervention, mandatory actions will be needed to achieve the outcomes required to achieve the 80 x 30 goals. As a chartered city that operates both an electric and a gas utility, Palo Alto has possession of tools to lower carbon emissions that many communities lack. One challenge is that medium and high intervention actions, in particular those involving mandates or gas bans, present a variety of legal issues. The City must either comply with or secure changes to a myriad of state and federal laws that would otherwise constrain some promising approaches. Local community support and voter approval may be an important step. Direct advocacy at the state level, for some if not all of the medium and high intervention actions, may also be necessary. Electric Vehicles Mobility Buildings 2021 to 2022 • Targeted outreach to MFR and lower income residents, including assistance with charger installation for MFR buildings. • Continue to provide rebates and technical assistance for workplace charging. • Implement shared micro-mobility service to provide last-mile connection • Allocate funding for on-demand transit service • Allocate funding for TMA, expand geographic scope of TMA to entire City • Initiate Bike Plan update • Start implementing smart parking infrastructure in public garages • Raise awareness on GHG, health and safety benefits of all-electric appliances • Expand electrification incentives to cover space heating and cooking equipment for residential and nonresidential customers • Expand program services targeting MF buildings and low- income households to include electrification projects • Expand program services to non-residential facilities to electrify water and space heating systems • Develop extensive Citywide promotion of walking, bicycles, and small electric vehicles like e-bikes and scooters, and other alternative transportation modes for all types of trips. • Raise awareness of emissions savings and other benefits of EVs and available incentives for those who cannot use alternative modes. • Create incentives for e-bikes and light EVs. 2022 to 2023 • Launch direct-install program for EV charging with on-bill financing • Funding for charger installation for low income residents • Residential EV credit – electric bill discount for registered EVs • Update and strengthen public and private TDM programs • Adopt telecommuting policy for local employers to align with regional targets. • Complete Bike Plan Update • Designate vehicle-free streets to encourage economic activity and recreational uses. • Identify additional funding sources for 2023-2030 Mobility measures. • Revise employee parking permit fees to make transit a competitively priced commute mode • Offer on-bill financing for electrification projects • Mandate major alterations of SFRs to meet all-electric requirements, ideally via Reach Code • Mandate non-residential new construction projects to meet all- electric requirements ideally via Reach Code • Adopt mandate to require end- of-life replacement of mixed-fuel rooftop packaged HVAC systems with electric heat pump systems starting in 2023 • Non-binding ballot measure to indicate community interest in adopting carbon pricing in 2024. ATTACHMENT A Electric Vehicles Mobility Buildings 2023 • Explore adopting a mandate that all MFR buildings and employers must provide at least some EV charging capacity by a date certain (TBD, but prior to 2030) – or equivalent program to deliver EV charging capacity to MFR residents. • Institute Safe Routes for Adults program • Install short-term on-street bicycle parking in business districts and major retail centers • Expand e-bike and e-scooter infrastructure throughout Palo Alto, especially at transit stations and stops, job centers, community centers, and other destinations. • Institute paid parking on-street and in public garages in Downtown and California Ave area • Aggressively implement adopted programs and drive high levels of participation. • Continue public outreach. 2024 • Alternative commute mandate – explore limiting workplace parking for single occupancy ICE vehicles • Institute project to build 30 miles of Bicycle Boulevard /Traffic Calming facilities over next 20 years • Revise minimum parking requirement standards to reduce number of trips and VMT • Explore ballot measure to adopt carbon pricing for commuter and visitor parking. • Explore ballot measure to authorize disconnection of gas service to single-family residential areas while greatly reducing multi-family and non-residential natural gas use. 2025 • Work with employers to provide incentives for employees using EVs or alternate commute • Install speed limit signage and markings to make streets more bicyclist and pedestrian friendly and safe. • Mandate end-of-life replacement of gas furnaces in multifamily units with heat pump systems starting in 2026, ideally via Reach Code • Mandate the replacement of gas cooktop in multifamily units with electric alternatives starting in 2026, ideally via Reach Code 2026 • Carbon pricing gradually increases and City continues to provide programs to ease EV adoption and charger installation • Initiate program to install 50 miles of protected class-4 bike lanes over the next 20 years • If approved, begin gas main disconnection to single family residences • Aggressively implement adopted programs and drive high levels of participation. • Continue public outreach. 2027 • Initiate program to install 10 miles of multi-use paths over the next 20 years 2028 • Initiate program to install transit signal priority equipment • Traffic signal related equipment improvement to improve traffic flow, reducing idling time and associated GHG emissions 2029 • Initiate program to install 10 miles of bicycle highways program for next 20 years • Construct 8 protected intersections for biking and walking ATTACHMENT A Electric Vehicles Mobility Buildings 2030 • Construction of bus rapid transit lanes and queue jump lanes to speed bus travel I I Attachment B: Sustainability and Climate Action Plan Update Report Table of Contents 1. Palo Alto’s 2019 Greenhouse Gas Emissions Inventory 1.a. Overview of Methodology for Quantifying Greenhouse Gas Emissions 1.b. Palo Alto’s 2019 GHG Emissions 1.c. Transportation and Mobile Sources 1.d Natural Gas Use 1.e. Solid Waste 1.f. Wastewater 2. Business as Usual Forecast 2.a. “Business-as-usual” (BAU) emissions 2.b. Additional Emissions Reductions Needed to Achieve 80% Reduction 3. Adjusted Business as Usual Forecast 3.a. The Impact of Remote Work 3.b. Electric Vehicle Adoption Trends 3.c. Adjusted Business as Usual Forecast 4. Impact Analysis 4.a. Outcomes needed to achieve 80% Reduction from 1990 Levels 4.b. Estimated Costs to Achieve 80% Reduction from 1990 Levels 4.c. Cost of Delaying Action 5. Carbon Neutrality 1. Palo Alto’s 2019 Greenhouse Gas Emissions Inventory 1.a. Overview of Methodology for Quantifying Greenhouse Gas Emissions Cities represent the single greatest opportunity for tackling climate change, as they are responsible for more than 70 percent of global energy-related carbon dioxide emissions. The first step for cities to realize their potential is to identify and measure where their emissio ns come from. There are two types of Greenhouse Gas (GHG) emissions inventories: 1. Generation-based GHG inventory – This measurement method helps a community understand its level of emissions based on community energy use. It includes 1) direct consumption of energy, 2) consumption of energy via the electrical grid, and 3) emissions from the treatment/decomposition of waste. This is the industry-accepted methodology for quantifying community GHG emissions, with emissions reported by emission source category1. 2. Consumption-based GHG inventory – This measurement method helps a community understand its level of emissions based on consumption. It offers an alternative, more holistic, approach for quantifying emissions within a community, quantifying 1 There are two reporting frameworks commonly used by cities: the U.S. Community Protocol and the Global Protocol for Communities (GPC). Palo Alto uses the GPC framework. ATTACHMENT B Page 2 of 26 consumption of goods and services (including food, clothing, electronic equipment, etc.) by residents of a city, with emissions reported by consumption category. Staff did not complete a consumption-based GHG inventory, though staff believes there would be value in completing one eventually. The California Air Resources Board (CARB) has been tasked with developing an implementation framework and accounting to track consumption - based emissions over time.2 In particular, this framework needs to address how to account for the embodied emissions in the food, goods, and services the community purchases that are not covered by generation-based GHG inventories. While Palo Alto will await State guidance on how to account for these consumption-based emissions reductions, the community can work to reduce these emissions in the meantime. In 2014, World Resources Institute, C40 Cities Climate Leadership Group (C40) and ICLEI – Local Governments for Sustainability (ICLEI)3 partnered to create global standard protocol for GHG inventories. The GHG Protocol standard for Cities, also known as GPC, provides a robust framework for accounting and reporting city-wide greenhouse gas emissions. The GPC is the official protocol specified by the Global Covenant of Mayors and defines what emissions must be reported and how. In addition, this inventory draws on methods from the U.S. Community Protocol4, which provides more detailed methodology specific to U.S. communities. It seeks to: • Help cities develop a comprehensive and robust GHG inventory to support climate action planning • Help cities establish a base year emissions inventory, set reduction targets, and track their performance • Ensure consistent and transparent measurement and reporting of GHG emissions between cities, following internationally recognized GHG accounting and reporting principles • Enable city inventories to be aggregated at subnational and national levels • Demonstrate the important role that cities play in tackling climate change, and facilitate insight through benchmarking – and aggregation – of comparable data Palo Alto’s first generation-based inventory was completed for 2005 and then extrapolated for 1990 (the baseline year). Beginning in 2010, new community GHG inventories were completed annually, enabling Palo Alto to track progress over time. The 2019 Palo Alto GHG inventory uses the approach and methods provided by the GPC and was completed by AECOM. Inventory calculations were performed using the ClearPath5 tool. The City’s GHG inventory conforms to the GPC Basic protocol. 2 Executive Department State of California. (2019). Executive Order B -55-18 to Achieve Carbon Neutrality. https://www.ca.gov/archive/gov39/wp-content/uploads/2018/09/9.10.18-Executive-Order.pdf. 3 Formerly the International Council for Local Environmental Initiatives, renamed in 2003 to ICLEI – Local Governments for Sustainability. 4 https://icleiusa.org/us-community-protocol/ 5 https://icleiusa.org/clearpath/ ATTACHMENT B Page 3 of 26 For the 2019 GHG inventory to comply with the GPC Basic protocol, additional existing emissions sources were included for the first time: Airport Emissions, Off -road Vehicles, Caltrain Commuter Rail, Composting, and Palo Alto Landfill Gas Flaring. Wastewater biosolids treatment is a new emissions source that was added due to the closure of the sewage sludge incinerators (more information can be found in section 1.f). Palo Alto Landfill Gas Fugitive Emissions are also no longer included since the landfill has since been capped. In addition, natural gas use is now separated into three categories: Commercial Energy, Industrial Energy, and Residential Energy. The GPC Basic protocol describes three emissions scopes for community emissions: • Scope 1: GHG emissions from sources located within the city boundary, such as stationary fuel consumption. • Scope 2: GHG emissions occurring because of the use of grid-supplied electricity, heat, steam, and/or cooling within the city boundary • Scope 3: All other GHG emissions that occur outside the city boundary as a result of activities taking place within the city boundary This inventory follows the city-inducted framework in the GPC, which totals GHG emissions attributable to activities taking place within the geographic boundary of the city6. Under the BASIC reporting level as defined by GPC, the inventory requirements cover scope 1 and scope 2 emissions from stationary energy and transportation, as well as all emissions resulting from waste generating within the city boundary. 1.b. Palo Alto’s 2019 GHG Emissions In 2019, Palo Alto emitted an estimated 482,327 metric tons (MT) of carbon dioxide equivalent (CO2e) from the residential, commercial, industrial, transportation, waste, water, and municipal sectors.7 In comparison to the 1990 base year, that is a 38.2 percent decrease in total community emissions, despite a population increase of 23.6 percent during that same time period. A comparison of 1990 and 2019 GHG emissions is shown in Figure 1 and Table 1. The full comparison between the two inventories can be found in Attachment C: 1990 vs. 2019 Greenhouse Gas Emissions by Sector and Subsector. As mentioned in section 1.a., additional existing emissions sources were included in the 2019 GHG inventory to comply with the GPC Basic protocol (Airport Emissions, Off-road Vehicles, Caltrain Commuter Rail, Composting, and Palo Alto Landfill Gas Flaring). As shown in Attachment C, a total of 23,493 MT CO2e was added from GHG emissions sources that were not included previously, accounting for 4.9 percent of total emissions. As a result of these additions, it is no longer possible to make a direct comparison with previous inventories. We can still compare to the 1990 baseline, but with the understanding that total GHG emissions would be 458,834 MT C O2e for a 41.2 percent 6 https://ghgprotocol.org/sites/default/files/standards/GHGP_GPC_0.pdf 7 Carbon dioxide equivalent is a unit of measure that normalizes the varying climate warming potencies of all six GHG emissions, which are carbon dioxide (CO2), methane (CH4), nitrous oxide (N2O), hydrofluorocarbons (HFCs), perfluorocarbons (PFCs), and sulfur hexafluoride (SF 6). For example, one metric ton of nitrous oxide is 210 metric tons of CO2e. ATTACHMENT B Page 4 of 26 reduction from 1990 levels, rather than a 38.2 percent reduction below 1990 levels. At this time, staff does not recommend adjusting previous inventories or the 1990 baseline to include the additional emissions sources. The amount of GHG emissions from additional sources is relatively small, at 4.9 percent of total emissions. Palo Alto completes a GHG inventory on an annual basis. Future inventories will all need to comply with the GPC Basic Protocol, and as such, will need to include the same additional emissions sources that were included in the 2019 GHG inventory. In order to compare the 2019 GHG inventory and future GHG inventories to the 1990 baseline, we could either remove the additional emissions sources for comparison purposes, or acknowledge that methodologies for calculating GHG emissions are constantly improving and evolving and that we will strive to use the most accurate method for calculating GHG emissions instead of trying to duplicate the methodology used in 1990. Figure 1: 1990 vs 2019 GHG Emissions by Sector Table 1: 1990 vs 2019 GHG Emissions by Sector Sector 1990 GHG emissions (MT CO2e) 2019 GHG emissions (MT CO2e) Percent Change in Emissions (%) On-Road Transportation 331,840 293,413 - 11.6% Additional Transportation Sources 21,668 n/a Natural Gas Use 194,000 153,509 - 20.9% Natural Gas Fugitive Emissions 4,718 5,009 + 6.2% Wastewater 8,504 2,197 - 74.2% Solid Waste 55,057 6,531 - 88.1% Brown Power Supply (Electricity) 186,000 - 100% Total GHG Emissions (MT CO2e) 780,119 482,237 - 38.2% Palo Alto Citywide Greenhouse Gas Emissions by Sector 900,000 ■ Brown Power Supply 800,000 (Electricity) Q) ■ Solid Waste N 0 u 700,000 -0 I-600,000 ■ Wastewater ~ "' 500,000 C: 0 ■ Natural Gas Fugitive 'iii .!!! 400,000 Emissions E LU ■ Natural Gas Use I..!) 300,000 J: I..!) 200,000 ■ Additional Transportation 100,000 Sources 0 ■ On-Road Transportation 1990 2019 ATTACHMENT B Page 5 of 26 As shown in Figure 2, the two largest categories of emissions are transportation and mobile sources (including on-road transportation, airport emissions, off-road vehicles, and Caltrain commuter rail) and natural gas use (including residential, commercial, and industrial). Figure 2: 2019 GHG Emissions by Sector Transportation and mobile sources include emissions from private, commercial, and fleet vehicles driven within the City’s geographical boundaries, as well as the emissions from public transit vehicles and the City-owned fleet. Off-road vehicles include airport ground support, construction and mining, industrial, light commercial, portable equipment, and transportation refrigeration. Natural gas use includes emissions that result from natural gas consumption in both private and public sector buildings and facilities, and residential, commercial, and industrial sources. Fugitive Emissions related to natural gas consumption are calculated separately and are discussed in Section 1.d. The City’s electricity supply has been carbon neutral since 2013, when Council approved a Carbon Neutral Electric Resource Plan, committing Palo Alto to pursuing only carbon-neutral electric resources and effectively eliminating all GHG emissions from the City's electric portfolio. Natural Gas Use, 31.8% Electricity Use, / 0% Solid Waste, 1.4% Natural Gas Fugitive Emission s, 1.0% Wastewater, 0.4% Transportation and Mobile Sources, 65.3% ATTACHMENT B Page 6 of 26 1.c. Transportation and Mobile Sources In 2019, transportation and mobile sources accounted for roughly 65 percent of total 2019 GHG emissions in Palo Alto. As shown in Table 2, transportation and mobile sources consist of: • On-Road Transportation – This includes all daily vehicular trips made entirely within the Palo Alto city limits, one-half of daily vehicular trips with an origin within Palo Alto city limits and a destination outside of Palo Alto city limits (this assumes that Palo Alto shares half the responsibility for trips traveling from other jurisdictions), and one-half of daily vehicular trips with an origin outside Palo Alto city limits and a destination within Palo Alto city limits (this assumes that Palo Alto shares the responsibility of trips traveling to other jurisdictions). Vehicular trips through Palo Alto are not included because Palo Alto cannot solely implement policies that influence the trip-making behavior. Rather, through trips are assigned to other jurisdictions that can influence either the origin or destination side of the trip-making behavior. • Airport Emissions – This includes emissions from take-offs and landings from trips that start and end at Palo Alto Airport. This includes emergency services h elicopters, sightseeing helicopters, and training flights. Flights that take -off from Palo Alto Airport but land elsewhere, and flights that land in Palo Alto Airport but take-off from elsewhere are not included per GPC Basic. • Off-road Vehicles - This includes airport ground support (based on take-offs and landings), construction and mining, industrial (based on employment data), light commercial (based on employment data), portable equipment (e.g. back-pack leaf blower, based on service population), and transportation refrigeration units (based on service population). • Caltrain Commuter Rail – This includes emissions from Caltrain travel within Palo Alto. Table 2: 2019 Transportation and Mobile Sources Subsector 2019 GHG emissions (MT CO2e) Percent of Total Emissions (%) On-Road Transportation 293,413 60.8% Airport Emissions 2,192 0.5% Off-road Vehicles 14,634 3.0% Caltrain Commuter Rail 4,842 1.0% Total Transportation & Mobile Sources 315,081 65.3% Estimating vehicles miles traveled (VMT) is a complicated process and is one of the few emissions sources that the City does not estimate annually. Forecasts of on-road transportation emissions are typically based on outputs from a travel forecasting model, other accounting-type method (sketch models), or Big Data (vehicle navigation data from built-in GPS and location- based services data from cell-phones). The last time VMT was estimated was in 2016. However, due to different methodologies used, one cannot directly compare the 2016 and 2019 estimates. One can, however, compare the 2019 estimate with the 2015 estimate generated from the same model run. Per the current Santa Clara Valley Transportation Authority ATTACHMENT B Page 7 of 26 transportation model, in 2015 Palo Alto’s annual VMT was roughly 930,313,940 compared to 952,584,400 in 2019. While the overall annual VMT increased, the daily VMT per service population (residents plus employees) decreased slightly from 16.5 in 2015 to 16.4 in 2019. On- road transportation accounts for approximately 60.8 percent of Palo Alto’s total emissions, which is a 4.2 percent decrease from 2018 and an 11.6 percent decrease from 1990. Transportation emissions in all of California have increased since 2013.8 As mentioned previously, this is the first year that airport emissions, off-road vehicles, and Caltrain commuter rail are included in the GHG inventory. Due to the lack of prior data, there are no Key Actions related to reducing airport emissions or off -road vehicles emissions in this S/CAP. However, these emissions could be included in future work plans or updates to the S/CAP. Caltrain electrification is a key component of the Caltrain Modernization program9, with Caltrain scheduled to be electrified in 2022. Once the Caltrain Modernization pr ogram is complete, most of the Caltrain commuter rail emissions will be eliminated. 1.d Natural Gas Use In 2019, natural gas emissions accounted for 31.8 percent of total 2019 GHG emissions in Palo Alto, which is a 1.6 percent increase from 2018 and a 20.9 percent decrease from 1990. As shown in Table 3, Palo Alto’s total natural consumption was 28,867,162 therms. Residential energy accounts for 15 percent of total emissions, commercial energy accounts for 13.9 percent of total emissions, and industrial energy – which include 6 MT CO2e from the COBUG natural gas generator for emergency use – accounts for 3 percent of total emissions. City Council unanimously approved Palo Alto’s Carbon Neutral Natural Gas Plan on December 5, 2016. The Natural Gas Plan, implemented on July 1, 2017, achieves carbon neutrality for the gas supply portfolio by 1) purchasing high-quality carbon offsets equivalent to our City and community natural gas emissions; 2) pursuing efficiency strategies to reduce natural gas use, and 3) seeking opportunities to fund local offsets that finance actual emissions reductions in Palo Alto and the surrounding region. As a bridging strategy, carbon offsets are being purchased in an amount equal to the GHG emissions caused by natural gas use within the City. However, offsets are not included in this GHG inventory. Table 3: 2019 Natural Gas Use Subsector Consumption (Therms) 2019 GHG emissions (MT CO2e) Percent of Total Emissions (%) Residential Energy 13,565,360 72,149 15.0% Industrial Energy 2,707,034 14,373 3.0% Commercial Energy 12,954,768 66,987 13.9% Total Natural Gas Use 28,867,162 153,509 31.8% 8 California Air Resources Board. (2021). Improved Program Measurement Would Help California Work More Strategically to Meet Its Climate Change Goals. http://auditor.ca.gov/pdfs/reports/2020-114.pdf. 9 https://calmod.org/ ATTACHMENT B Page 8 of 26 Natural Gas Fugitive Emissions Natural gas is mainly methane (CH4), some of which escapes during the drilling, extraction, and transportation processes. Such releases are known as fugitive emissions. The primary sources of these emissions may include equipment leaks, evaporation losses, venting, flaring and accidental releases. Methane is a potent greenhouse gas – approximately 25 times more powerful than carbon dioxide over a 100-year timescale. In 2019, natural gas fugitive emissions accounted for 1 percent of total 2019 GHG emissions in Palo Alto, which is an increase of 4.8 percent from 2018 and 6.2 percent from 1990. Per the GPC, fugitive emissions from natural gas are based on overall community consumption and a leakage rate of 0.03%. As mentioned in Section 1.a., the GPC Basic methodology includes GHG emissions attributable to activities taking place within the geographic boundary of the city. As such, the 2019 GHG inventory does not include a category of emissions that are called “upstream emissions”. Upstream emissions are discussed in further detail in section 4.a. 1.e. Solid Waste Palo Alto's current solid waste diversion rate is 81 percent. “Diversion” includes all waste prevention, reuse, recycling and composting activities that “divert” materials from landfills. In 2015, the national average of landfill diversion was 34.7 percent. In 2017, California’s statewide diversion rate was 58 percent, which continues to outpace the 50 percent diversion mandate set for local jurisdictions.10 The City uses the diversion rate to measure progress on waste reduction and resource conservation goals. The diversion rate of 81% is an improvement from the rate of 62% in 2007 but has remained relatively flat the last few years. As part of the 2016 S/CAP Framework, Council adopted a goal of 95% diversion of materials from landfills by 203011. Waste sector emissions accounted for 1.4 percent of total 2019 GHG emissions in Palo Alto, which is a decrease of 88.1 percent from 1990. However, it must be noted that solid waste emissions were calculated using a different methodology for the 2019 GHG inventory.12 In addition, as shown in Table 4, the 1990 inventory included Palo Alto Landfill Gas Fugitive emissions, whereas the 2019 inventory did not, and the 2019 inventory included composting emissions at the ZeroWaste Energy Development Company’s (ZWED) Dry Fermentation Anaerobic Digestion (AD) Facility in San Jose, CA as well as Palo Alto Landfill Gas Flaring Emissions while the 1990 inventory did not. In 2019, emissions from landfills located within the community accounted for 79.5 percent of total waste emissions. 10 https://www.calrecycle.ca.gov/lgcentral/goalmeasure/disposalrate/graphs/estdiversion 11 https://www.cityofpaloalto.org/civicax/filebank/documents/64814 12 The 1990 Solid Waste emissions were calculated using the EPA WARM methodology, which includes lifecycle emissions and emissions from landfilling recyclable material; waste was landfilled inside and outside Palo Alto. The 2019 Solid Waste emissions were calculated using the ICLEI (Local Governments for Sustainability) ClearPath tool, which includes composting and Palo Alto landfill gas flaring emissions; waste is landfilled and composted outside of Palo Alto and methane flared in closed landfill. ATTACHMENT B Page 9 of 26 Table 4: 1990 vs 2019 Solid Waste Emissions by Subsector Subsector 1990 GHG emissions (MT CO2e) 2019 GHG emissions (MT CO2e) Percent Change in Emissions (%) Composting (ZWED) Not included 731 n/a Palo Alto Landfill Gas Flaring Not included 281 n/a Palo Alto Landfill Gas Fugitive 24,325 Not included n/a Landfill Waste 30,732 5,519 - 82.0% Total 55,057 6,531 - 88.1% Waste emissions result from organic material decomposing in the anaerobic conditions present in a landfill and releasing methane (CH4) – a greenhouse gas much more potent than CO2. Organic materials (e.g., paper, plant debris, food waste, etc.) generate methane within the anaerobic environment of a landfill while non-organic materials (e.g., metal, glass, etc.) do not. 1.f. Wastewater In 2019, wastewater emissions accounted for 0.4 percent of total 2019 GHG emissions in Palo Alto, which is a decrease of 29.7 percent from 2018 and 79 percent from 1990. These emissions include wastewater biosolid treatment (which includes biosolid composing, anaerobic digestion, and incineration) and wastewater treatment and effluent. Wastewater biosolid treatment is a new emissions source. In 2019, The City of Palo Alto’s Regional Water Quality Control Plant (RWQCP) replaced the City facility with the largest energy use - the sewage sludge incinerators - with a more environmentally friendly Sludge Dewatering and Truck Loadout Facility. The updated treatment process will reduce climate-warming GHG emissions by approximately 15,000 MT of CO2e per year – this approximates the carbon dioxide emissions of 3,000 passenger cars. The replacement technologies dewater the sludge and send it to farm areas to produce agricultural soil supplements. ATTACHMENT B Page 10 of 26 Figure 3: RWQCP Historical Total Greenhouse Gas Emissions 2. Business as Usual Forecast AECOM developed a forecast of future emissions to understand what reduction measures are needed to meet the 80 x 30 goal. 2.a. “Business-as-usual” (BAU) emissions This projection represents the emissions expected if the 2019 patterns of travel, energy and water consumption, and waste generation/disposal persist. It includes emissions reductions as a result of implementation of all the City Council approved plans, policie s, and ordinances that were approved on or before 2019. This projection factors in the expected rate of county population and job growth and is considered in the absence of any statewide measures, policies, or actions that would reduce emissions, including state legislation and/or any other policies or procedures adopted after 2019. The projection also includes additional existing emissions sources to comply with the GPC Basic protocol (Airport Emissions, Off-road Vehicles, Caltrain Commuter Rail, Composting, and Palo Alto Landfill Gas Flaring). The Forecasting Growth Indicators used for the BAU forecast are shown in Table 5. RWQCP Historical Total Greenhouse Gas Emissions 35,000 ■ Anthropogenic ~ Biogenic ATTACHMENT B Page 11 of 26 Table 5: Forecasting Growth Indicators Subsector Growth Indicator Source On-Road Transportation Emission Factor: EMFAC VMT: Fehr & Peers CARB EMFAC model Fehr & Peers Airport Emissions Assumed no growth NA Off-Road Vehicles EMFAC-ORION CARB EMFAC-ORION model Caltrain Commuter Rail (will be electrified in 2022) Caltrain Ridership Projections + 2022 Rail Electrification Caltrain Residential Energy City Provided Forecasts City of Palo Alto Commercial Energy City Provided Forecasts City of Palo Alto Industrial Energy City Provided Forecasts City of Palo Alto COBUG Generator Assumed no growth NA Natural Gas Fugitive Emissions Natural gas growth rate City of Palo Alto Landfill Waste Service Population City of Palo Alto Composting (ZWED) Service Population City of Palo Alto Closed Landfill Gas Flaring Assumed no growth NA Wastewater Treatment and Effluent Service Population City of Palo Alto Wastewater Biosolid Treatment* Service Population City of Palo Alto *Includes composting, anaerobic digestion, and incineration. Incineration not forecasted as discontinued in 2019. The BAU emissions forecast is shown in Figure 4 and Table 6. Figure 4: "Business as Usual" Greenhouse Gas Emissions Forecast "Business as Usual" Greenhouse Gas Emissions Forecast 900,000 800,000 700,000 600,000 500,000 400,000 300,000 200,000 100,000 0 1990 2019 2030 2040 ■ On-Road Transportation ■ Additional Transportation Sources ■ Natural Gas Use ■ Natural Gas Fugitive Emissions ■ Wastewater ■ Solid Waste ■ Brown Power Supply ( Electricity) ATTACHMENT B Page 12 of 26 Table 6: "Business as Usual" Greenhouse Gas Emissions Forecast GHG emissions (MT CO2e) Sector 1990 2019 2030 2040 On-Road Transportation 331,840 293,413 243,851 239,110 Additional Transportation Sources 21,668 19,929 22,575 Natural Gas Use 194,000 153,509 133,393 119,426 Natural Gas Fugitive Emissions 4,718 5,009 4,346 3,891 Wastewater 8,504 2,197 1,927 2,046 Solid Waste 55,057 6,531 6,989 7,403 Brown Power Supply (Electricity) 186,000 Total GHG Emissions (MT CO2e) 780,119 482,237 410,435 394,451 2.b. Additional Emissions Reductions Needed to Achieve 80% Reduction Palo Alto City Council committed to an 80 percent reduction in emissions below 1990 levels by 2030. Through this commitment, Palo Alto will be doing its part in helping California achieve the statewide target of a 40 percent reduction below 1990 levels by 2030 and will place Palo Alto on the path to achieving the statewide target of carbon neutrality before 2045. Under a BAU scenario, Palo Alto emissions are projected to be 47.4 percent below 1990 levels in 2030 (410,435 MT CO2e) and 49.4 percent below 1990 levels in 2040 (394,451 MT CO2e). Therefore, more aggressive actions will be needed to achieve the 80 percent reduction. Between 1990 and 2019, Palo Alto reduced its emissions by 297,792 metric tons (MT) of carbon dioxide equivalents (MT CO2e) to achieve 38.2 percent below 1990 levels at a rate of 1.3 percent per year. To achieve the 80 x 30 goal, Palo Alto must meet a GHG emissions target of 156,024 MT CO2e. Palo Alto will need to reduce total emissions by about 326,303 MT CO2e, or an additional 254,411 MT CO2e beyond “Business-as-usual” projections, at a rate of 3.8 percent per year, significantly increasing the scale and speed of reductions. As shown in Table 7, the emissions reduction required by 2030 on top of business-as-usual projected emissions, 254,411 MT CO2e, is the equivalent of taking 54,964 passenger vehicles off the road for an entire year. Table 7: GHG Emissions Projection and Reduction Target 1990 2019 2030 2040 Emissions (MT CO2e) 780,119 482,327 410,435 394,451 Percent change from 1990 baseline - ~38.2% ~47.4% ~49.4% Emissions Target - % below 1990 baseline - - 80% - Emissions needed on top of BAU projections - - 254,411 - ATTACHMENT B Page 13 of 26 Figure 5: “Business as Usual” GHG Emissions Projection and Reduction Target 3. Adjusted Business as Usual Forecast The BAU forecast developed by AECOM is based on 2019 trends, and therefore leaves out the impacts of the COVID-19 pandemic and the increase in remote work as well as the market shifts from Governor Newsom’s September 2020 Executive Order N-79-20, which directs California to require that, by 2035, all new cars and passenger trucks sold in the state be zero -emission vehicles. Staff adjusted AECOM’s BAU forecast to include these factors, using data and assumptions specific to Palo Alto. 3.a. The Impact of Remote Work The pandemic has created the need for people who can work from home to do so. It has also shown that remote work or telework - working either full- or part-time from home, from a 'telecenter' located close to home, or from other locations – is possible. In December 2020, the Bay Area Council Economic Institute, in partnership with the Bay Area Regional Collaborative, released a study on Remote Work in the Bay Area13. The study does not represent the number of people working remotely today, or that have in the past or will in the future. It instead focuses on the occupations that could be completed remotely, offering an upper bound for potential remote work adoption. The analysis revealed several key findings, including: • It is impossible to disaggregate remote work effects from COVID-19 effects, and this is especially true when it comes to housing markets. • In the Bay Area, the share of people who reported primarily working from home grew 13 http://www.bayareaeconomy.org/wp-content/uploads/2020/12/BACEI_RemoteWork_12.21.20.pdf 254,411 MT CO2e 900,000 800,000 700,000 600,000 500,000 400,000 300,000 200,000 100,000 0 1990 2005 -Actual Emissions 2013 2019 -BAU Emissions Forecast 2030 Target : 80% Reduction below 1990 levels 2040 -so x 30 Target ATTACHMENT B Page 14 of 26 from 3.4 percent in 1990 to 6.4 percent in 2018. • 51% (569,941) of the jobs in Santa Clara County are eligible for remote work. • Among remote eligible workers in Santa Clara County, 6 percent (or 34,196 of all remote eligible workers) take transit to work, while 75 percent (or 427,456 workers) drive alone. The remaining 19% (or 108,289 remote eligible workers) commute via carpool, on bike, walking, or they already work from home. • Reduced demand for commute trips will ease congestion for those that do travel, creating emissions benefits. • Remote work could also reduce transit ridership. • The overall impact of remote work on GHG emissions is inconclusive. Some studies that account for factors such as increased non-work travel and home energy use have found remote work to have a neutral or negative impact on overall energy use. • If households relocate to more dispersed locations in the region because they only need to be in the office a few days per week, more drivers could take to the roads for longer commutes between locations that are not currently connected by transit. • If many households relocate to less transit and pedestrian-friendly locations, there could be a localized impact on the environment as people become more reliant on cars as a primary mode. Shifting travel behavior could also call for a re-prioritization of transportation investments away from commute trips to urban centers and toward local transit, bicycle, and pedestrian infrastructure. • Remote work has equity considerations, as eligibility rises as average income increases • With the daytime population much lower in many commercial districts across the region and higher in many suburbs, there will be fiscal impacts for cities that collect business taxes based on employee counts. In Palo Alto, assuming that 50 percent of employees are eligible for remote work and that (if supported by city policies and programs) they opt for 2 days a week of remote work, then commute VMT could be reduced by 8 percent to 11 percent14 compared to 2019 levels. On- road transportation emissions in the 2030 BAU forecast could be reduced an additional 3.8 percent from remote work. This translates into a 3 percent reduction in on -road transportation emissions relative to 2019 levels, or a 2.8 percent reduction of on-road transportation emissions relative to 1990 levels and slightly more than 1 percent of total 1990 emissions. Palo Alto staff has adjusted the business as usual forecast to incorporate this trend. 3.b. Electric Vehicle Adoption Trends Palo Alto currently has one of the highest electric vehicle (EV) adoption rates in the country. In the US, approximately 2.3 percent of new car sales were EVs in 2019. In California, 8.1 percent 14 While permanent increases in work-from-home behavior will lead to decreased commute VMT, this reduction is off-set by additional travel for non-commute reasons, such as increased VMT from driving to run errands and getting more deliveries at home. Studies show that the degree of this added non-commute VMT ranges from 15% of the total saved, to more than 100% of the total saved. ATTACHMENT B Page 15 of 26 of new car sales were EVs15, and in Palo Alto that number was about 30 percent. The models used to calculate AECOM’s BAU forecast do not include Palo Alto specific EV adoption rates – they use Santa Clara County EV adoption rates. In addition, the AECOM BAU forecast for EV adoption uses the CARB EMFAC model, which utilizes consumer survey data from 2015-2017 as the core of its consumer choice model. Since the data was collected before the widespread availability of mass market EVs, the EMFAC forecast for EV market share is likely too low. Auto analysts and economists do not agree on future US auto sales, however, in CA, some analysts have predicted that EV sales could reach 50% of new car sales by 2030.16 And, starting in 2035, Executive Order N-79-20 will go into effect, which directs California to require all new cars and passenger trucks sold in the state be zero-emission vehicles. 17 Furthermore, many automakers have committed to going fully electric or pivoting heavily towards electric vehicles within the next two decades, with a large number of new EV models becoming available in the next few years. This will undoubtedly accelerate the rate of EV adoption in Palo Alto. For EVs, market share is projected to increase from the current 30% to 50% in 2030, based on a CA-specific EV sales forecast18. Based on these sales trends and a fleet evolution and attrition model, 31 percent of all Palo Alto registered vehicles are estimated to be EVs by 2030 under the BAU scenario. It is important to note that the BAU scenario excludes any impact from local policies, but will still benefit from regional, state, and federal policies, as well as industry and societal trends. Palo Alto is particularly challenging to forecast because its EV market share is one of the highest in the nation and well above even the CA average, and this can either result in continued strong growth or an eventual plateau in demand. Assuming that 31 percent of all Palo Alto registered vehicles will be EVs by 2030 without additional City action, on-road transportation emissions in the 2030 BAU forecast could be reduced an additional 11.3 percent through EV adoption. This translates into a 9 percent reduction of on-road transportation emissions relative to 2019 levels or an 8 percent reduction of on-road transportation emissions relative to 1990 levels and 4 percent of total 1990 emissions. 3.c. Adjusted Business as Usual Forecast As mentioned previously, the AECOM BAU forecast is based on 2019 trends, and therefore leaves out the increase in remote work as well as EV market shifts. Therefore, staff incorporated remote work trends and EV adoption trends to create an adjusted BAU forecast. As explained above, remote work is estimated to result in a 2.8 percent reduction of on-road transportation emissions relative to 1990 levels, and EV adoption is estim ated to result in an 8 15 https://evadoption.com/ev-sales/ev-sales-forecasts/ 16 UBS Investment Bank, March 2021. “EVs Shifting into Overdrive: How will electric cars re -shape the auto industry?”. https://neo.ubs.com/static/login.html?origin=/shared/d24IiDrju8G4f 17 https://www.energy.ca.gov/data-reports/reports/integrated-energy-policy-report/2020-integrated-energy- policy-report-update 18 UBS Investment Bank, March 2021. “EVs Shifting into Overdrive: How will electric cars re -shape the auto industry?”. https://neo.ubs.com/static/login.html?origin=/shared/d24IiDrju8G4f ATTACHMENT B Page 16 of 26 percent reduction in on-road transportation emissions relative to 1990 levels. Under staff’s adjusted BAU scenario, Palo Alto emissions are projected to be 52.1 percent below 1990 levels in 2030 (373,769 MTCO2e) and 59.6 percent below 1990 levels in 2040 (314,968 MTCO2e). Figure 6: Adjusted “Business as Usual” GHG Emissions Projection and Reduction Target 4. Impact Analysis Although these are unprecedented times, with a global pandemic, an economic downturn, and other challenging events, Council directed staff to continue with its work on developing strategies to achieve the ambitious 80 x 30 goal. Staff modeled the outcomes needed to achieve the 80 x 30 goal, keeping in mind updated climate science and the global impacts of climate change, as well as the increased community awareness needed. While there are multiple strategies to reduce Palo Alto’s emissions, the scenario described below repres ents the most technically feasible and cost-effective pathway staff and its consultant could identify. As noted above, while legal analysis of these preliminary measures is underway, additional in - depth review will be needed as implementation details emer ge. 4.a. Outcomes needed to achieve 80% Reduction from 1990 Levels Table 8 and Figure 7 below show more detail on the sources of the City’s various types of emissions. Table 8 shows the 1990, 2019, and 2030 target emissions for each source. The table breaks down transportation and building emissions among various sectors that contribute to total emissions. Transportation emissions from residential and fleet vehicles registered i n Palo 217,745 MT CO2e ~36,666 MT CO2e 900,000 800,000 700,000 600,000 500,000 400,000 300,000 200,000 100,000 0 1990 2005 2013 2019 2030 2040 -Actual Emissions -BAU Emissions Forecast -Adjusted BAU Emissions Forecast -80x 30Target ATTACHMENT B Page 17 of 26 Alto as well as commuter and visitor vehicle emissions are included. In the buildings category, emissions are broken down between single-family residential, multi-family residential, and non- residential emissions. There are different challenges associated with reducing emissions among each of these sectors. Some are more expensive than others to electrify and some are technically more challenging. Reducing transportation emissions is the lowest cost emissions reduction alternative, but in the short term19, the City has fewer policy levers to affect reductions in transportation emissions, particularly for visitors. As a result, the City is unable to rely solely on vehicle electrification to achieve its goals and must focus efforts in the buildings sector as well. In this area emissions- reducing technologies are readily available to electrify all gas appliances and systems in single- family homes and to electrify some gas appliances in multi-family and commercial buildings, but electrification of multi-family and commercial may be more expensive because it is more technically complicated. For some types of end uses, staff and its consultant did not have the time or resources to do as thorough a study as they would have liked, but with the tim e allotted, were unable to identify electric heat pump alternatives to gas equipment in existing buildings. With more time and research, staff may be able to identify alternatives. As a result, staff has had to rely heavily on single-family building electrification to get close to achieving the 80 x 30 goal. Still, staff’s preliminary analysis only achieves 72 percent reductions below 1990 levels, leaving an 8% gap to be closed through some combination of deeper vehicle electrification, multi-family and commercial building electrification, carbon dioxide removal, and funding emissions reductions outside of Palo Alto. Table 8: Emissions by Source and Milestone Source 1990 Levels 2019 Emissions 2030 Target Emissions % Reduction from 1990 levels Residential / Fleet Transportation 331,840 84,100 19,200 65% Commuter Transportation 101,600 11,000 Visitor Transportation 107,700 85,000 Single-Family Building Gas Use 194,000 49,500 0 61% Multi-Family Building Gas Use 22,600 18,400 Non-Residential Building Gas Use 81,400 57,100 Electricity 186,000 0 0 100% Other emissions sources 68,279 35,400 30,700 55% SUBTOTAL, Key Actions Analyzed To-Date 780,119 482,300 221,300 -72% Additional Emissions Reductions TBD 65,300 -8% TOTAL 780,119 482,300 156,000 80% 19 Land use changes can reduce driving significantly over the long term by locating housing closer to services and employment. The land use assumptions in the BAU analysis reflect the 2017 Comprehensive Plan. Different land use scenarios were not modeled as part of this analysis due to budget constraints. Future S/CAP work should include resources to model how growth can be accommodated in a way that does not increase GHG emissions. ATTACHMENT B Page 18 of 26 Figure 7: Contributions of Various Emissions Reduction Measures to Achieving Emissions Goals Figure 8 summarizes the cost per metric ton of carbon dioxide equivalent (MT CO2e) reduced for various emissions reductions technologies, while Attachment D, Chart D-3 shows the costs in more detail. To provide some context for the costs in the chart, the current cost of building renewable energy in California as a way to reduce carbon is $30 per MT CO2-e to $60 per MT CO2-e,20 though the CPUC projects that will rise to around $200 per MT CO 2-e by 2030.21 The cost of renewable natural gas is $270 per MT CO2-e to $450 per MT CO2-e.22 20 Calculated based on current Renewable Energy Credit prices ($/MWh) converted to $/ton CO2-e 21 Extracted from CPUC RESOLVE model by a City consultant, E3 22 Forecast by E3 using PATHWAYS models developed for forecasting RNG prices in California Energy Commission study titled Deep Decarbonization in a High Renewables Future. 800 K 700 K cc <t: 600 K LU ~ ,..__ ~ 500 K V) z 0 vi ~ ~ LU (!) r (!) 400 K 300 K 200 K 100K 1990 EMISSIONS 8% additional reductions needed 2019 EM ISSIONS 2030 EM ISSIONS Staff-Forecasted BAU EV Adoption -Telecommuting -Mobility Policies -EV Policies -Buildings Policies ~Additional Reductions TBD --AECOM Business As Usual ----80% Reduction 2040 EMISSIONS ATTACHMENT B Page 19 of 26 Figure 8: Cost per Metric Ton for Various Types of Emissions Reduction Actions In summary, staff and AECOM have identified the following outcomes in 2030 as necessary to achieve the 80 percent reduction: • Commute travel is reduced 10 percent via telecommuting • Vehicle Miles Traveled (VMT) are reduced 8 to 11 percent • 85 percent of all Palo Alto new vehicle purchases are EVs, up from 30 percent now, which results in a vehicle fleet that is 44 percent EVs (50 percent in single -family households, 33 percent in multi-family) • 40 percent of commuter trips into Palo Alto and 30 percent of visitor trips are made in EVs (35 percent overall). This is up from 3 percent right now. • Virtually all single-family gas appliances and virtually all commercial rooftop HVAC units are electrified • Significant additional multi-family and commercial building electrification and other emissions reductions to be determined • An additional 65,0000 MT CO2e of emissions reductions are achieved through other measures. More detail on the key actions modeled to achieve the above outcomes can be found in Attachment A. Table 8 and Figure 7 only represent the direct emissions reductions associated with electrifying vehicles and buildings; that is, the emissions reductions associated with burning fuel in a gas tank or natural gas appliance. However, there are also emissions associated with pro ducing and transporting gasoline or natural gas to the home, gas pump, or commercial building due to leakage that occurs during transportation. These fuels, when released directly to the • • Other comm ,erciall and ml!Jlti -family act ions are expensive -at least those ana llyzed so far. • Other single-family appliances liike cooktops and clothes dryers that are more expensi1ve, but l!Jnlock other savings Most costly ($600-$1800/MT) Mor e costly ($200-$600/MT) Less costly (<$160/MT) • Lowest cost building e llectr ification is single -fami lly space and water heating and commer,c··a1 rooftop HVA.C. --+---+--Brea k eve n ~ • Allternative commute and ,electric Net s_avi ng,s ~ vehicle p rog rams are a n•et savi1ngs ($0 to-$400/MT) ATTACHMENT B Page 20 of 26 atmosphere, have significantly higher global warming potentials than the carbon dioxide released when they are burned. Attachment D, Table D-1 shows what the emissions reductions look like when these “upstream emissions” from transportation are taken into account. Even more significantly, natural gas has a very high short-term global warming potential. Attachment D, Table D-2 shows emissions when looking at warming occurring over the next 20 years rather than a full 100 years. Consideration of these upstream emissions further emphasizes the importance of reducing natural gas use in buildings, rather than pursuing strategies with even greater emphasis on vehicle electrification. While these upstream emissions are worth examining to understand the additional potential impacts of fossil fuel use, they are not included in industry-standard GHG inventories and are just included for informational purposes. The true impact of upstream emissions outside of Palo Alto city boundaries would be more accurately reflected in a consumption-based GHG inventory. The momentum created by these strategies will continue past 2030, and staff forecasts achieving 78 percent reductions by 2035 and 80 percent by 2036 or 2037, even without an additional 65,000 MT CO2e of emissions reductions through other measures. It is also worth noting that some of the effects of these proposed strategies will generate emissions reductions that are not counted in the City’s GHG inventory. For example, if a Palo Alto resident converts to an EV as part of one of our programs, only their driving within Palo Alto counts t owards reducing emissions counted in the City’s GHG inventory. If they commute out of Palo Alto, for example, the community can only count part of that vehicle trip towards its emissions savings, but of course they are reducing emissions for the entire jou rney. Those unclaimed emissions are very large, equal to another 6% to 7% reduction in emissions if they could be claimed. 4.b. Estimated Costs to Achieve 80% Reduction from 1990 Levels Based on staff and consultant modeling, and depending on what strategies Council chooses to pursue, staff estimates the total cost to implement the goals and key actions analyzed is roughly $740 million in 2021 dollars (note that there would be an addition al cost to achieving the remaining 8% GHG emissions reductions, but this cost is unknown at this time). This investment would take place through 2030. This is the up-front capital cost for the necessary vehicle and mobility investments, investments in charging infrastructure, and investments in appliances and building infrastructure. It includes utility improvements needed to support the transformation. It does not include operational savings to customers from eliminating natural gas bills, gasoline expenditures, and the value of reduced vehicle maintenance. If municipal bond financing is available, it might be possible to spread the cost of these measures over time, thus making the cost more manageable. The viability of this approach, however, is uncertain. Municipal debt is typically issued to fund public improvements, rather than improvements to private property. Further analysis will be required to assess which S/CAP program elements may be supported by bond financing. Furthermore, if the City sells d ebt to create a large pool of up-front funding for programs, the City will need to pledge acceptable security for the debt, and identify a source of funds for debt service. ATTACHMENT B Page 21 of 26 Another means of spreading costs over time would involve the creation of an “on -bill financing” program, by which customers are charged on their utility bill for a financing obligation they voluntarily incur. The Bay Area’s Water Upgrades $ave Program is a local example.23 Administration challenges associated with on-bill financing can vary widely, depending on repayment details such as loan security, whether the loan runs with the property and can be transferred upon resale, and the cost of defaults. Potential bond financing of the cost of an on - bill financing program raises additional legal and feasibility questions. For purposes of this analysis, however, financing is assumed, and the cost in 2030 is roughly $53 million per year (in 2021 dollars), which is equivalent to about 30 percent of the entire community’s total annual gas and electricity bills (CY 2019). In its analysis, staff assumed financing of all eligible property-related measures over the life of the measure. There are also significant annual operational savings to customers from these measures. These annual operational savings are expected to be roughly $43 million per year in 2030, making achievement of the S/CAP goals nearly a net benefit to the community. By 2033, benefits are estimated to match costs and from then forward electrification would represent a net benefi t to the community as a whole. This means achieving the S/CAP goals would likely result in lower household and business expenses throughout the community in the long term, which could make residents and businesses open to funding other community investments such as undergrounding utilities or fiber to the home. However, the costs and the operational savings are not spread evenly across the community, and this creates a variety of issues. For example, in 2030, a homeowner who owns an EV is projected to experience, over time and on average, a $116/month decrease in household expenses. This is due to vehicle fuel and maintenance savings. A homeowner who electrifies their home is projected to see a $107/month increase. On balance, the savings due to the electric vehicle are similar to the cost of the building electrification work, making these emissions reductions roughly offset each other in cost. But it also means that residents who electrify their vehicles but do not electrify their homes see a large net savings in their monthly household expenses when compared to residents who do both. This creates a d isincentive to building electrification. Figure 9 shows the costs associated with electrification for single-family residents and multi-family residents with and without electrified buildings, illustrating this issue. There are other issues. Without incentives or taxes, the community’s more vulnerable members will face steep costs to electrify (not shown in Figure 9). They may still be able to take advantage of the cost savings of vehicle electrification if they have access to vehicle charging. But building electrification will be out of their reach. And if gas rates start to rise because others in the community are electrifying, that could negatively impact their ability to manage household expenses. This is another reason income-qualified incentives are a critical need for 23 https://www.bayren.org/waterupgradessave ATTACHMENT B Page 22 of 26 this program. Similar issues are faced by vulnerable businesses, such as neighborhood-serving businesses that face tighter margins than larger businesses, or nonprofits. Businesses, because they do not have as many vehicle-related emissions, will not see a net savings from emissions reductions, just a cost, as shown in Figure 9. This leads to a disincentive to electrify. And, of course, because staff was unable to identify as many emissions reductions for businesses, residents end up bearing most of the cost impacts. Since emissions reduction is a community goal, it may be viable to have some sectors of the community that have more difficulty electrifying fund incentives for other sectors of the community that can do so at lower cost. That way, the lowest cost emissions reductions measures in the community are implemented, but the cost is shared by the entire community. The same principle applies to funding electrification for members of the community that may have trouble affording electrification. This includes low-income members of the community, neighborhood businesses, and non-profits. Non-rate-based funding for this type of financial support would be needed, absent a change to current law, since California constitutional provisions governing municipal fees and charges (Propositions 26 and 218, for example) require utility rates to be cost based absent voter approval. A variety of taxation approaches are being explored by staff, including parcel taxes and carbon taxes. Many of these taxation ideas represent novel and expanded uses of municipal taxing power, mainly because they would use restricted revenues in new ways. For example, while a parcel tax is one legal option, applying the revenue raised from that tax to fund improvements on private property is unprecedented. While voters might, in theory, approve this type of electrification funding as a component of utility rates or as a parcel tax, this approach is likely to invite challenge from taxpayer advocacy groups. It is difficul t to predict how a court might rule if a measure such as this were challenged, and legal challenges, even if successfully opposed, would likely delay or disrupt implementation and raise costs. Advocacy for state-level support, both in the legislature and at key regulatory agencies such as CARB, the CEC and CPUC, could provide important support for novel approaches and reduce legal risk. Setting aside these concerns for purposes of this analysis, staff evaluated one hypothetical scenario to see what the potential impact might be on different sectors if costs were spread across the community using some form of tax, to be determined. Figure 10 shows the results. In this hypothetical scenario, segments of the community needing protection from cost increases were assumed to be exempted from the tax. In addition, 100 percent of building improvements24 required to support electrification would be paid for by the City using tax revenues. Bond financing is assumed to spread the costs out over a longer period. For t his hypothetical scenario the segments requiring an exemption from the tax and/or additional 24 All single-family gas appliances, multi-family gas wall heaters, non-residential rooftop packaged HVAC systems, major facility gas efficiency measures, and all residential and non -residential vehicle charging. ATTACHMENT B Page 23 of 26 funding were assumed to be income-qualified residents, small businesses, and non-profits. The analysis showed that a combination of a parcel tax and utilization of non-rate-based funding sources25 enabled costs to be spread more broadly across the community. Such a scenario would require customer groups that are less able to electrify, such as large commercial customers, agreeing to tax themselves to fund electrification for other groups of customers. In this scenario the annual tax averages to roughly $300 per year per non -exempt single-family household ($25 per month), $120 per non-exempt multi-family household ($10 per month), and $1.35 per square foot of commercial space for those segments that pay the tax (this scenario assumes several segments do not pay). Figure 9: Costs for Various Groups in the Palo Alto Community without Tax / Incentive System26 25 For example, the City is allocated allowances under the State’s Cap and Trade program that is required to auction, and it is required to use the revenue for local decarbonization or return it to ratepayers. The City realizes similar revenues through its participation in the State’s Low Carbon Fuel Standard program. 26 This chart does not include a separate estimate of the costs to low-income customers, neighborhood businesses, or other vulnerable customers, but costs for these customers are the same as the costs cited for homes, apartments, and businesses in the absence of taxes and incentives. $15 0 $1.50 Vl :E +-' -~ 0 0 ..c Vl $10 0 $1.00 0 t:: (I) +-' u.. (I) Vl C: (I) c.. :::, (I) I ... 0 0 :'S! $50 $0.50 n:l ... I Vl :::, a.. C: (I) C"- c::: $0 $0.00 V') -~ (I) ... I --... +-' t2.0 0 (I) C: C: ..... c.. (I) n:l Vl -$5 0 -$0.50 t; "C ..c (I) Vl u Vl 0 (I) C: u c::: >-(I) -$1 00 -$1.00 I ..c c.. n:l C: +-' X :::, 0 C: LLJ C: z 0 -$150 -$1.50 C: ... ~ <( .E "C "C "C "C "C "C w w w w w w ~ !: i: i: .; !: ·;:: ,_ ·;:: ,_ ·;:: ,_ ..., ..., ..., ..., ..., ..., u u u u u u w w w w w w i::.::i ..... i::.::i 1.1.J i::.::i 1.1.J I I I C: C: C: 0 0 0 z z z Homes Apa rt me nt s Non -R esid e nt ial ATTACHMENT B Page 24 of 26 Figure 10: Costs for Various Groups in the Palo Alto Community with Tax / Incentive System27 These are all preliminary results, but they give some early indications of what might be possible with this system of taxes and incentives. 4.c. Cost of Delaying Action Achieving the 80 percent reduction target over a longer period of time could reduce the total cost to electrify because more appliance replacement takes place at end of life and more new all-electric construction and major renovation, which is cheaper than retrofits, will take place. In addition, the slower pace of implementation would reduce the maximum annual financing cost incurred by the community. However, the cost of delaying emissions reductions is high. While carbon of fsets can mitigate carbon emissions impacts, they cannot be considered a replacement for direct emissions reductions. The IPCC 2018 Special Report stated that deep emissions reductions, carbon neutrality, and negative emissions are all required to keep global warming to 1.5°C. Achieving carbon neutrality and negative emissions both require the removal of carbon dioxide from the atmosphere through new forest growth and processes to remove carbon dioxide from the air and store it underground. The faster the direct emissions reductions achieved, the less carbon dioxide removal is required. 27 This chart does not include a separate estimate of the costs to low-income customers, neighborhood businesses, or other vulnerable customers, but costs for low-income residential customers are slightly lower than the costs cited for homes or apartments because they are exempt from the tax. For neighborhood businesses, there is little or no impact on their costs due to exemption from the tax and the availability of City -funded electrification. "'C 0 .S:::. Vl Q) +-' Vl C: ::J Q) 0 "'C I "vi C: ~ Q) .... t),C 0 C: -C'O Vl .s:::. Q) u ~ > Q) -c.. -:;; X C: 1.1.J 0 2: $150 $100 $50 $0 -$50 -$100 -$150 -1 11 _•_1_ "C w (;:: ·;:: ...., u w i:i:i I C: 0 z Ho mes "C w (; ·.:::: ..., u w i:i:i "C w (;:: ·;:: ..., u w i:i:i I C: 0 z "C w i;::: 'i: ..., u w i:i:i Apartments "C w '-= ·;:: ..., u w i:i:i I C: 0 z Non-Residential $1.50 $1.00 $0.50 $0.00 -$0.50 -$1.00 -$1.50 Vl "E Q) 0 t Ll.. Q) Q) c.. .... 0 ro ._ ::J c... C"- V) .!!1 .... +-' Q) C: c.. Q) "'C t, "vi 0 Q) u c:: I ro c: ::J 0 C: z C: .... <( .E ATTACHMENT B Page 25 of 26 The IPCC 2018 Special Report identified several example pathways involving slower and faster rates of emissions reduction and the carbon dioxide removal associated with each pathway. These pathways were labeled P1 through P4 in the Special Report’s Summary for Policymakers. The P1 scenario involved the most rapid global emissions reductions and required little carbon dioxide removal beyond new forest growth. The P4 scenario involved continued emissions growth through 2030 followed by rapid decarbonization and achievement of carbon neutrality by mid-century, but it required massive investments in carbon dioxide removal using expensive industrial methods and underground storage. Staff estimated Palo Alto’s share of global carbon dioxide removal based on global and local 2010 emissions under each scenario. As shown in Figure 11 below, the cost of the additional carbon dioxide increases very significantly the slower emissions are reduced. This is both because much more carbon must be removed from the atmosphere in the P4 scenario, but also because much more of that carbon dioxide removal takes place using expensive industrial processes, since there is limited potential for new forest growth globally.28 Figure 11: Cost of Estimated Palo Alto Share of Carbon Dioxide Removal Based on Ca rbon Dioxide Removal Required for various IPCC 2018 Report Scenarios 28 For this estimate staff used $12.50/metric ton for the cost of carbon dioxide removal through new forest growth, based on quotes from offset brokers. This price is likely to rise over the next decade as demand increases due to the increasing cost of allowances in the California Cap and Trade Program (offsets can be used to fulfill a portion of allowance obligations). This is likely a low-end estimate of forestry costs. For industrial carbon dioxide removal staff used a price of $65/metric ton based on the 2020 Lawrence Livermore Laboratories “Getting to Neutral” study of the cost of carbon dioxide removal in California (This is also likely a low-end estimate, given that the cost estimates in the study were based on a coordinated statewide rollout of these technologies. The study can be found at: https://www-gs.llnl.gov/content/assets/docs/energy/Getting_to_Neutral_Executive_Summary.pdf 0 200 400 600 800 1,000 1,200 P1 (LED)P2 (S1)P3 (S2)P4 (S5) Co s t ( $ m i l l i o n ) - ATTACHMENT B Page 26 of 26 5. Carbon Neutrality When the 80 x 30 goal was adopted by Council in 2016, California’s emissions reduction goal was to reduce greenhouse gas emissions 80% below 1990 levels by 2050. In September 2018, Governor Brown issued California Executive Order B-55-18, setting the goal of achieving carbon neutrality as soon as possible (by 2045 at the latest), and maintaining net negative net emissions from that point forward. The Executive Order explains that the carbon neutrality goal is layered on top of the state’s existing commitments to reduce GHG emissions 40% below 1990 levels by 2030 (as codified in SB 32), and 80% below 1990 levels by 2050. The basic definition of carbon neutrality is taking action towards the goal of achieving net zero emissions – reducing the amount of greenhouse gas put into the atmosphere and then “offsetting” an equivalent amount of any remaining emissions using carbon removal methods like new forest growth and removing carbon from the air and storing it underground. This carbon neutrality target is based on the Paris Agreement29 which calls for preventing average global temperature from rising more than 2°C (3.6°F) above pre -industrial levels and pursuing efforts to keep warming below 1.5°C (2.7°F). According to the Intergovernmental Panel on Climate Change (IPCC), holding temperature rise below 1.5°C will mean global emissions of CO2 will need to decline 45 percent from 2010 levels by 2030 and reach net zero by 2050. 29 Paris Agreement, https://unfccc.int/files/essential_background/convention/application/pdf/english_paris_agreement.pdf Attachment C: 1990 vs. 2019 Greenhouse Gas Emissions by Sector and Subsector Sector and Subsector 1990 GHG emissions (MT CO2e)1 2019 GHG emissions (MT CO2e) Percent Change in Emissions (%) Percent of Total Emissions (%) Total Transportation and Mobile Sources 331,840 315,081 -5.1% 65.3% - On-Road Transportation 331,840 293,413 - 11.6% 60.8% - Airport Emissions Not Included 2,192 n/a 0.5% - Off-road Vehicles Not Included 14,634 n/a 3.0% - Caltrain Commuter Rail Not Included 4,842 n/a 1.0% Total Natural Gas Use 194,000 153,509 - 20.9% 31.8% - Commercial Energy Not calculated 66,987 n/a 13.9% - Industrial Energy Not calculated 14,373 n/a 3.0% - Residential Energy Not calculated 72,149 n/a 15.0% Natural Gas Fugitive Emissions 4,718 5,009 + 6.2% 1.0% Total Wastewater 8,504 2,197 - 74.2% 0.5% - Wastewater Biosolid Treatment2 n/a 812 (new) n/a 0.2% - Wastewater Treatment and Effluent 8,504 1,385 -83.7% 0.3% Total Solid Waste 55,057 6,531 - 88.1% 1.4% - Composting (ZWED) Not Included 731 n/a 0.2% - Palo Alto Landfill Gas Flaring3 Not Included 281 n/a 0.1% - Palo Alto Landfill Gas Fugitive 24,325 n/a4 n/a n/a - Landfill Waste 30,732 5,519 - 82% 1.1% Brown Power Supply (Electricity) 186,000 n/a - 100% n/a Total GHG Emissions (MT CO2e) 780,119 482,237 - 38.2% - Total Additional Emissions Sources 23,493 4.9% - Total Emissions Excluding Additional Sources 458,834 -41.2% 1 Source: 2016 S/CAP Framework and 2016 Earth Day Report 2 Includes biosolid composting, anaerobic digestion, and incineration 3 2016 Earth Day Report labeled these emissions as biogenic 4 Not included because the landfill was closed TO: HONORABLE CITY COUNCIL FROM: ED SHIKADA, CITY MANAGER DATE: CITY COUNCIL MEETING APRIL 19, 2020 SUBJECT: AGENDA ITEM NUMBER 7- City Council Review of the Sustainability and Climate Action Plan (S/CAP) Update Report, Provide Feedback on Policy Tools, and Direction to Staff to Implement an S/CAP Engagement Strategy for three S/CAP engagement tracks that includes outreach to Council, Commissions, and the community. The Sustainability and Climate Action Plan (S/CAP) Update Report refers to an Attachment D: Supplement Charts and Tables, which was inadvertently excluded from Staff Report 12009. Attached is Attachment D: Supplement Charts and Tables. NOTE: This attachment was updated after the April 19 meeting to correct Charts D-1 and D-2. in Chart D-1 the Transportation emissions for single-family, multi-family, and non-residential sectors were incorrect for the CY 2019 and projected CY 2030 columns, though the total Transportation emissions were correct in each column. In Chart D-2 the transportation emissions reductions shown for the single-family, multi-family, and non- residential sector did not properly exclude certain “business as usual” emissions reductions, meaning the emissions reductions were overstated by approximately 9,500 MT/year in total. These errors were not present in the main body of the report or other Attachments. _______________________ _______________________ Brad Eggleston Ed Shikada Director of Public Works City Manager 7 UPDATED DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 ATTACHMENT D: SUPPLEMENTAL TABLES AND CHARTS Chart D-1: Emissions by Source and Milestone Chart D-2: Contributions of Various Emissions Reduction Measures to Achieving Emissions Goals1 1 1 The land use assumptions in the analysis reflect the 2017 Comprehensive Plan. The analysis assumes that land use won’t change beyond what is in the Comprehensive Plan. Mobility policy actions could have more efficacy with land use changes. DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 Chart D-3: Key Actions by Cost per Metric Ton of Carbon Dioxide Equivalent Reduced 2 2 Cost per metric ton shown as a range from a low-cost scenario to a high-cost scenario DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 4 of 4 Table D-1: Emission by Source and Milestone (with Upstream Emissions, GWP100 3) 1990 Levels 2019 Emissions Target Emissions % Reduction from 1990 levels Residential / Fleet Transportation1 444,666 112,694 25,728 65% Commuter Transportation 136,144 14,740 Visitor Transportation 144,318 113,900 Single-Family Building Gas Use 265,780 67,815 - 61% Multi-Family Building Gas Use 30,962 25,208 Non-Residential Building Gas Use 111,518 78,227 Electricity 226,920 0 0 100% Other emissions sources 68,300 35,400 30,600 55% SUBTOTAL, Key Actions Analyzed To-Date 1,005,666 638,851 288,403 -71% Additional Emissions Reductions TBD 87,303 -9% TOTAL 1,005,666 638,851 201,100 80% Table D-2: Emission by Source and Milestone (with Upstream Emissions, GWP204) 1990 Levels 2019 Emissions Target Emissions % Reduction from 1990 levels Residential / Fleet Transportation1 530944 134,560 30,720 65% Commuter Transportation 162,560 17,600 Visitor Transportation 172,320 136,000 Single-Family Building Gas Use 478404 122,067 - 61% Multi-Family Building Gas Use 55,732 45,374 Non-Residential Building Gas Use 200,732 140,809 Electricity 279,000 0 0 100% Other emissions sources 68,300 35,400 30,700 80% SUBTOTAL, Key Actions Analyzed To-Date 1,356,648 883,371 401,103 -70% Additional Emissions Reductions TBD 129,803 -10% TOTAL 1,356,648 883,371 271,300 -80% 3 100-year Global Warming Potential. 4 20-year Global Warming Potential. DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 TO: FROM: DATE: HONORABLE CITY COUNCIL ED SHIKADA, CITY MANAGER CITY COUNCIL MEETING APRIL 19, 2021 SUBJECT: AGENDA ITEM NUMBER 7- City Council Review of the Sustainability and Climate Action Plan (S/CAP) Update Report, Provide Feedback on Policy Tools, and Direction to Staff to Implement an S/CAP Engagement Strategy for three S/CAP engagement tracks that includes outreach to Council, Commissions, and the community. The Sustainability and Climate Action Plan (S/CAP) Update Report refers to an Attachment D: Supplement Charts and Tables, which was inadvertently excluded from Staff Report 12009. Attached is Attachment D: Supplement Charts and Tables. NOTE: This attachment was updated after the April 19 meeting to correct Charts D-1 and D-2. in Chart D-1 the Transportation emissions for single-family, multi-family, and non-residential sectors were incorrect for the CY 2019 and projected CY 2030 columns, though the total Transportation emissions were correct in each column. In Chart D-2 the transportation emissions reductions shown for the single-family, multi-family, and non- residential sector did not properly exclude certain “business as usual” emissions reductions, meaning the emissions reductions were overstated by approximately 9,500 MT/year in total. These errors were not present in the main body of the report or other Attachments. _______________________ _______________________ Brad Eggleston Ed Shikada Director of Public Works City Manager 7 UPDATED DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 ATTACHMENT D: SUPPLEMENTAL TABLES AND CHARTS Chart D-1: Emissions by Source and Milestone Chart D-2: Contributions of Various Emissions Reduction Measures to Achieving Emissions Goals1 1 1 The land use assumptions in the analysis reflect the 2017 Comprehensive Plan. The analysis assumes that land use won’t change beyond what is in the Comprehensive Plan. Mobility policy actions could have more efficacy with land use changes. DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 Chart D-3: Key Actions by Cost per Metric Ton of Carbon Dioxide Equivalent Reduced 2 2 Cost per metric ton shown as a range from a low-cost scenario to a high-cost scenario DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 4 of 4 Table D-1: Emission by Source and Milestone (with Upstream Emissions, GWP100 3) 1990 Levels 2019 Emissions Target Emissions % Reduction from 1990 levels Residential / Fleet Transportation1 444,666 112,694 25,728 65% Commuter Transportation 136,144 14,740 Visitor Transportation 144,318 113,900 Single-Family Building Gas Use 265,780 67,815 - 61% Multi-Family Building Gas Use 30,962 25,208 Non-Residential Building Gas Use 111,518 78,227 Electricity 226,920 0 0 100% Other emissions sources 68,300 35,400 30,600 55% SUBTOTAL, Key Actions Analyzed To-Date 1,005,666 638,851 288,403 -71% Additional Emissions Reductions TBD 87,303 -9% TOTAL 1,005,666 638,851 201,100 80% Table D-2: Emission by Source and Milestone (with Upstream Emissions, GWP204) 1990 Levels 2019 Emissions Target Emissions % Reduction from 1990 levels Residential / Fleet Transportation1 530944 134,560 30,720 65% Commuter Transportation 162,560 17,600 Visitor Transportation 172,320 136,000 Single-Family Building Gas Use 478404 122,067 - 61% Multi-Family Building Gas Use 55,732 45,374 Non-Residential Building Gas Use 200,732 140,809 Electricity 279,000 0 0 100% Other emissions sources 68,300 35,400 30,700 80% SUBTOTAL, Key Actions Analyzed To-Date 1,356,648 883,371 401,103 -70% Additional Emissions Reductions TBD 129,803 -10% TOTAL 1,356,648 883,371 271,300 -80% 3 100-year Global Warming Potential. 4 20-year Global Warming Potential. DocuSign Envelope ID: 2D6AF9A9-29C0-462E-8FBF-2FC3655A52E3 Certificate Of Completion Envelope Id: 2D6AF9A929C0462E8FBF2FC3655A52E3 Status: Completed Subject: Please DocuSign: UPDATED At Places Memo CMR 12009 Item 7 Attachment D.pdf Source Envelope: Document Pages: 4 Signatures: 2 Envelope Originator: Certificate Pages: 2 Initials: 0 Tabatha Boatwright AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-08:00) Pacific Time (US & Canada) 250 Hamilton Ave Palo Alto , CA 94301 tabatha.boatwright@cityofpaloalto.org IP Address: 199.33.32.254 Record Tracking Status: Original 5/3/2021 10:03:03 AM Holder: Tabatha Boatwright tabatha.boatwright@cityofpaloalto.org Location: DocuSign Security Appliance Status: Connected Pool: StateLocal Storage Appliance Status: Connected Pool: City of Palo Alto Location: DocuSign Signer Events Signature Timestamp Brad Eggleston Brad.Eggleston@CityofPaloAlto.org Director of Public Works City of Palo Alto Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 174.194.141.127 Sent: 5/3/2021 10:04:57 AM Viewed: 5/4/2021 2:10:54 PM Signed: 5/4/2021 2:13:15 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Ed Shikada Ed.Shikada@CityofPaloAlto.org Ed Shikada, City Manager City of Palo Alto Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 199.33.32.254 Sent: 5/4/2021 2:13:17 PM Viewed: 5/4/2021 3:19:46 PM Signed: 5/4/2021 3:20:16 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Beth Minor beth.minor@cityofpaloalto.org City Clerk City of Palo Alto Security Level: Email, Account Authentication (None) Sent: 5/4/2021 3:20:18 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Carbon Copy Events Status Timestamp Jonathan Abendschein Jonathan.Abendschein@cityofpaloalto.org Assistant Director, Utilities Resource Management City of Palo Alto Security Level: Email, Account Authentication (None) Sent: 5/4/2021 3:20:19 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 5/3/2021 10:04:57 AM Certified Delivered Security Checked 5/4/2021 3:19:46 PM Signing Complete Security Checked 5/4/2021 3:20:16 PM Completed Security Checked 5/4/2021 3:20:19 PM Payment Events Status Timestamps City of Palo Alto (ID # 12041) City Council Staff Report Report Type: Action Items Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: Resolution to Extend Street Closure Authority and Discuss Parklet Program Title: Consideration of Actions and Direction to Support Community and Economic Recovery by: 1) Adoption of a Resolution to Extend the City Manager's Authority to Clos e Portions of University Avenue, California Avenue and Surrounding Streets for the Uplift Local Streets Program Until September 7, 2021; and 2) Provide Direction to Staff on the Extension, Discontinuance, or Efforts to Develop a Permanent Parklet Program F rom: City Manager Lead Department: Planning and Development Services Recommendation: Staff recommends that Council: (1) Adopt the attached resolution extending the City Manager’s authority to close portions of University Avenue and certain intersecting streets, and to close portions of California Avenue and certain intersecting streets until September 7, 2021 or another date certain; and (2) Provide direction to staff regarding the extension, discontinuance, and/or efforts to develop a permanent parklet program. Executive Summary: This report and recommendations concern two local pandemic community response and recovery programs: the Uplift Local Streets program and the temporary parklet program. Through the Uplift Local Streets program, portions of University Avenue, Ramona Street, and California Avenue have been closed to vehicular traffic to connect the community to outdoor activities such as dining, public art and more. With the current authorization for the program ending on May 31, 2021, this report seeks Council direction on the program’s future. The Council may extend the closure, allow the closure to sunset, or keep the closure on California Avenue while re-opening University Avenue. City of Palo Alto Page 2 The temporary parklet program expires on September 7, 2021. Dependin g on what the City anticipates being the future needs of the local community at that time, and how far the County will have come in ending the pandemic, the Council may want to extend the program or maintain that deadline. The Council may also direct staff to develop a permanent parklet program. If Council directs staff to develop a permanent program, staff recommend extending the temporary program deadline to provide adequate time to develop the permanent program and for current permittees to apply for and receive a permanent permit. Background: On March 4, 2020, California Governor Gavin Newsom declared a State of Emergency due to the threat of Coronavirus Disease 2019 (COVID-19). The City of Palo Alto and County of Santa Clara issued respective declarations of emergency shortly thereafter. Several City related efforts are tied to the City’s local proclamation of emergency including the street closures, eviction moratorium, face covering restrictions, and more. As such, the continuation of local programs may be limited as State, County, and City emergency restrictions are lifted. Since the beginning of the pandemic, shelter in place orders have been implemented, relaxed, re-implemented, and lifted. The shelter in place orders aimed to limit or prohibit certain activities in order to reduce the spread of COVID-19. Throughout the pandemic, California has experienced both surges in transmission and deaths from COVID-19, as well as periods of lower transmission, illness, and death. In addition, the state government has issued more specific and uniform guidance to a wide range of industries that allow many activities to resume in ways that reduce the risk of transmission of COVID-19. On August 28, 2020, California Governor Gavin Newsom published his Bluep rint for a Safer Economy. Among other things, the Blueprint created a 4 -tiered, color-coded rating system. Based on specific virus-related metrics, counties are rated. Based on its rating, different activities can resume in a county. After a Regional Stay at Home Order during December 2020 and January 2021, the state has returned to using the color-coded system. As of the writing of this report, Santa Clara County is in the orange tier, meaning moderate community spread of COVID-19 is occurring. The County is tracking current COVID-19 case counts and as of this writing, cases have plateaued, reflecting new variants that exist within the County and other areas of the State and nation. On April 6, 2021, Governor Newsom issued a press release stating that state would end the color-coded tier system on June 15. The system’s end depends on meeting two criteria:1 1. Sufficient vaccine supply for Californians 16 years and older who wish to be inoculated; 1 http://www.oesnews.com/governor-newsom-outlines-the-states-next-step-in-the-covid-19-pandemic-recovery- moving-beyond-the-blueprint/ City of Palo Alto Page 3 and 2. Hospitalization rates are stable and low. If these criteria are met, the state has said “common sense” regulations—such as mask wearing and vaccine or testing verification for large events—will stay in effect. Otherwise, the California economy will fully reopen. As mentioned above, the City’s local proclamation of emergency is the vehicle through which many of the current programs in response to the pandemic are authorized. As more is known about the specifics of the potential end to the COVID-19 color- coded tier system, staff will continue to evaluate impacts on the City’s regulations and bring forward areas for Council consideration as needed. Approval by the Food and Drug Administration of three vaccines against COVID -19 has led to nationwide efforts to inoculate as many people as possible as quickly as possib le. President Biden has set a goal that all states will offer the vaccine to adults ages 16 and over by May 1, 2021 and recently moved that date up to April 19, 2021 . Additionally, a goal has been set to ensure every American who wants a vaccine, can recei ve one by June 2021. Despite the goals, supplies of vaccines remain limited. As of April 2, 2021, 22.4% of Santa Clara County residents over the age of 16 had been completely vaccinated; 38.1% had received at least one dose. Local Actions Related to Outdoor Dining & Uplift Local Streets Throughout the pandemic, the City Council has provided leadership for Palo Alto through a truly unprecedented time. The City Council took several actions specifically related to business districts seeking to support community and business recovery efforts and connect the community to local outdoor activities. Two of those actions, the closure of certain public streets and the development of a temporary parklet program, are set to expire on May 31, 2021 and September 7, 2021, respectively. The “Uplift Local” program originally began as “Summer Streets.” On June 8, 2020, the Palo Alto City Council held a study session to discuss how the City might facilitate and enhance opportunities for outdoor dining and outdoor retail thro ughout the City of Palo Alto. Council approved Resolution 9909 on June 23, 2020 that authorized the City Manager to close certain portions of University Avenue and California Avenue. T he resolution also authorized the development and implementation of a temporary parklet program. The branding “Uplift Local” has since been expanded to incorporate a range of community support elements such as business promotions, public art, and community engagement in addition to street closures. On August 10, 2020, the City Council voted (7-0) to extend the temporary parklet program until September 7, 2021. This end date provided over 1 year from time of adoption for a restaurant to recover the cost of investing in a parklet. As the planned sunset of the temporary parklet program draws near, staff seek direction from the Council: (1) Shall the temporary program end? (2) Shall a permanent parklet program be developed? City of Palo Alto Page 4 Most recently, on November 9, 2020, the City Council voted 6-1 (DuBois dissenting) to extend the closures of portions of California Avenue and University Avenue to vehicular traffic until May 31, 2021. This resulted in the continuance of the Uplift Local street closures. Absent further Council action, the program will end on May 31, 2021. Discussion The Council is asked to consider and provide direction regarding (1) the sunset or continuance of the Uplift Local Streets program and (2) the future of the temporary parklet program. Understanding the current impacts of the pandemic and forecasting future impact s is foundational to the continuance or sunset of these programs. Both programs allow businesses to operate outdoors, which decreases the risk of spreading COVID-19. In addition, the Uplift Local Streets program also allows expanded areas for residents and visitors to enjoy the outdoors while remaining at a social distance. If the pandemic continues to recede and ultimately ends, the programs may no longer be needed as a public health measure. If, however, progress stalls or the County experiences increases in transmission, the programs may be needed. If the County’s metrics continue to improve, more activities will be allowed indoors and at greater capacities. As metrics improve, restrictions on a variety of activities are reduced. Table 1 shows the capacity restrictions at each tier for dining and retail. Table 1: Capacities for Certain Industries Under Blueprint for a Safer Economy Tier Indoor Dining Indoor Retail Gyms Purple: Widespread Outdoors only Open indoors 25% max capacity Outdoor only Red: Substantial Spread Open indoors 25% capacity Open indoors 50% max capacity Open indoors 10% max capacity Orange: Moderate Spread Open indoors 50% capacity Open indoors Open indoors 25% max capacity Yellow: Minimal Spread Open indoors 50% capacity Open indoors Open indoors 50% + saunas and steam rooms Possible end of State tiered system on June 15, 2021 At present, the distribution of vaccines and other factors are leading to improvements in Santa Clara County and throughout the Bay Area. Overall, trans mission of the virus and hospitalizations due to the virus have decreased. Anecdotally, a local jewelry retailer remarked that regular customers have begun returning to the store; with many proudly announcing they had received a vaccine. This may indicate that as the vaccine becomes more prevalent, hesitancy about being indoors may decrease. City of Palo Alto Page 5 Despite positive gains, some health experts warn that a resurgence in the virus could occur. A future resurgence could be caused by relaxed restrictions, increased travel, the presence of at least four more-contagious variants of the virus, insufficient supply of vaccine doses, and reluctance among many adults to get vaccinated.2 It is in this context that the Council is asked to consider extending, discontinuing, or modifying the local programs that have been enacted. Specifically, Council is asked to consider those programs originally authorized by resolution 9909. Other programs, such as allowing retail outdoors, were authorized by a temporary ordinance; the expiration of this ordinance is tied to the local proclamation state of emergency. The items contained within the ordinance shall remain in effect for the duration of the Local Emergency or until December 31, 2020, whichever is later.3 Uplift Local Program The Council authorized the City Manager to close certain streets to vehicular traffic through May 31, 2021 for the purposes of expanding outdoor activities. The authority includes University Avenue between High Street and Cowper, as well as 1 block north and 1 block south of University along the intersecting streets. The authority also includes California Avenue from El Camino Real to Birch, and intersecting streets. Staff recommend extending the authority for the street closures through September 7, 2021. This would allow the streets to be closed through Labor Day, seen as the traditional “end of summer.” The extension gives the City flexibility as the region continues to have positive gains, but lingering uncertainty. This would allow outdoor dining and retail to continue, and guard against returning too many activities indoors before herd immunity is reached. As the case to date, the City Manager could modify closures where feasible to balance pedestrian and vehicle access needs on individual blocks. If metrics improve significantly, the street closures may not be necessary or desirable. In this case, the City Manager will have the authority to end the closures. If, however, the resolution is not extended by Council action, street closures will end on May 31, 2021. Alternatively, the Council may connect the program to the state’s tiered system. In this scenario, the resolution would still have a fixed end date; but a clause would be added stating that the City Manager does not have the authority to close the streets when Santa Clara County 2 Assorted polls indicate sizeable portions (19% and 14%) of the adult American population say they will not get the COVID-19 vaccine. Reluctance, hesitancy, and outright refusal may continue spread of the virus and jeopardize herd immunity. https://www.forbes.com/sites/andrewsolender/2020/05/08/many-americans-say-they-would- refuse-a-coronavirus-vaccine/?sh=47ebafab71f6 3 Temporary Ordinance: https://www.cityofpaloalto.org/civicax/filebank/blobdload.aspx?t=63066.98&BlobID=77635 City of Palo Alto Page 6 exits the tiered system, as established by the State of California. The attached resolution (Attachment A) will need to be updated if Council prefers this option. Finally, Council may choose to extend to the City Manager the authority to close California Avenue through the summer and/or the fall, while discontinuing the authority for street closures on University Avenue. Downtown & University Avenue Currently, the Downtown Uplift Local program includes University Avenue from Ramona Street to Cowper Street. The program also includes ½ block of Ramona Street from Hamilton Avenue north towards University Avenue. See Attachment B for an aerial map. Staff have renewed efforts to assess the success of the street closure by counting the number of patrons, pedestrians, and cyclists on Uplift Local streets. Table 2 displays the level of activity on Uplift Local streets. With the recent Council approval of a contract for vehicle counts, additional traffic data is also being collected. As the weather improves, staff anticipates activity will increase. Evenings remain busier than daytime; and weekend (Friday night) is busier than weekdays (Wednesday). Table 2: University Avenue - Based on Peak of the Hour Activities 3/3/2021 Weekday Dinner 3/5/2021 Weekend Dinner 3/24/2021 Weekday Lunch Walking/Standing 75 80 77 Seated 74 182 87 Biking 5 No data 5 TOTAL 154 262 169 Table 3: University Avenue - Averages AVERAGES 3/3/2021 Weekday Lunch 3/5/2021 Weekday Dinner 3/24/2021 Weekend Dinner Walking/Standing 77 75 80 Seated 87 74 182 Biking 5 5 No data A survey to gather the preferences of local residents, businesses, and landlords is currently being conducted at the time of the development of this staff report . Staff will prepare this information for the City Council presentation, providing additional time for public input. Last year, when a survey was conducted regarding the Uplift Local Streets program, over 100 survey respondents voiced an interest in closing University Avenue to traffic every summer. City of Palo Alto Page 7 In the Downtown area, business owners and landlords remain divided regarding their preferences for opening or closing the streets to vehicular traffic. In Downtown, most retailers have not decided to display any merchandise outdoors, so the closed streets are occupied by restaurants. Many restaurants rely on availability of outdoor dining in the roadway to operate. The roadway provides an opportunity for more seating, in some cases allowing restaurants to return to move their indoor capacity completely outside. Even as indoor dining becomes allowed, patrons may be reluctant to dine indoors. Restauranters point out that the capacity for retail businesses, though diminished, has remained higher than the capacity for restaurants and that shoppers can continuously wear masks, while diners cannot. It should be noted that in the State’s yellow tier, the least restrictive tier, restaurants may seat up to 50% capacity indoors. Other businesses, however, feel that their customers need vehicular access to their location, or that the foot traffic is not a substitute for the exposure vehicular traffic provides. These businesses feel the street closure unfairly favors restaurants at their expense. In December 2020, the state prohibited outdoor dining. During that time, the streets opened to vehicular traffic again. At least one retailer reported their sales increased at that time. Some of the increases, however, may be attributed to the holiday shopping season. In late January 2021, outdoor dining became allowed again. The City asked ground floor businesses downtown to vote on whether or not they wanted to return to street closure, partial street closure, or to keep the street open. In the end, the votes favored a return to the current street closure footprint (which has been implemented since fall 2020). The results indicated a strong difference of opinion remained. The City has been working to find a solution that might allow Downtown to take advantage of the best parts of the Uplift Local policies. Council supported a $150,000 capital improvement project to develop a conceptual plan to redesign University Avenue. Early-stage implementation could use bollards or other means to close/open the streets for shorter periods of time; such as weekend only. This would relieve the tension of an “all or nothing” approach to the closures. Such a solution, however, will not be designed or implemented by May 31, 2021. If the street closure is not extended Downtown, restaurants could continue to operate outdoors via sidewalk dining and/or parklets, subject to continuation of a parklet program. California Avenue Currently, the California Avenue Uplift Local program includes California Avenue from El Camino Real to Birch Street. See Attachment B for an aerial map. Staff have renewed efforts to assess the success of the street closure by counting the number City of Palo Alto Page 8 of patrons, pedestrians, and cyclists on Uplift Local Streets. Table s 4 and 5 display the level of activity on Uplift Local Streets. These dates were colder than previous counts in summer 2020; still the trend of weekends being busier than weekdays holds. Additionally, though California Avenue’s Uplift Local Street footprint is shorter than University Avenue’s, the participation is comparable. Table 4: California Avenue - Based on Peak of the Hour Activities 3/3/2021 Weekday Lunch 3/5/2021 Weekend Dinner 3/24/2021 Weekday Lunch 3/24/2021 Weekday Dinner 3/26/2021 Weekend Dinner Walking/Standing 64 92 55 49 137 Seated 85 270 127 183 383 Biking 8 8 7 8 18 TOTAL 157 370 189 240 538 Table 5: California Avenue - Averages AVERAGES Weekday Lunch Weekday Dinner Weekend Dinner Walking/Standing 60 49 115 Seated 106 183 327 Biking 8 8 13 A survey to gather the preferences of local residents, businesses, and landlords is currently being conducted. Staff will prepare this information for the City Council presentation, providing additional time for public input. Last year, when a survey was conducted regarding the Uplift Local Streets program, over 100 survey respondents voiced an interest in closing University Avenue to traffic every summer. California Avenue businesses are more universally supportive of the street closures than Downtown. The density of restaurants, physical characteristics of the street, location of off- street parking, and mix of other businesses has led to greater support for street closures. Non - restaurant businesses—from gyms and hair salons to grocery stores and banks—have reported less disruption caused by the closure of the street to traffic than those in Downtown. Should Council choose to allow University Avenue to open to vehicular traffic, staff recommend Council giving the City Manager authority to close California Avenue to traffic through September 7, 2021. Under any scenario, consideration of longer term closure of any street would require evaluation of several factors. These include, for example: State of California Streets and Highways Code City of Palo Alto Page 9 limitations on local jurisdiction to close streets once the state of emergency concludes; access needs for properties fronting the streets; pedestrian, bicyclist, and disabled access and convenience; costs and fees for private use of the public right-of-way; access needs for public safety, utility, and public works operations; urban design and aesthetic standards; and, displacement of traffic onto surrounding streets and neighborhoods. Parklets Staff seek direction from the City Council regarding the future of the parklet program. The temporary parklet permits will expire on September 7, 2021, meaning the parklets must be removed on or before that date. Council could decide to extend the program. Any extension would be premised on the continuing state of local emergency or threat of increase in coronavirus circulation—as emphasized in the resolution as the reason for parklets. If the pandemic does in fact end, the temporary parklets cannot rely on the existing resolution without further action. In this context, staff seek Council direction. Council might maintain th e temporary parklet expiration date of September 7, 2021. Council may also direct staff to develop a permanent parklet program, in which case staff would also develop a transition plan. If the expiration date is maintained and the Council directs staff to explore a permanent program, there will likely be a gap between when the temporary parklets expire and a permanent program is enacted. During the gap, unless a temporary ordinance is established, the existing parklets would need to be removed. Program Adoption Since the adoption of the original resolution, the City has issued 32 encroachment permits for parklets in Palo Alto. Parklets allow restaurants to serve patrons outdoors where the risk of transmission of COVID-19 is reduced. The parklets must adhere to standards and guidelines issued by the Director of the Department of Public Works and incorporated by reference to the resolution. • At-grade and platform parklet permits = 32 + 2 under review • Encroachment permits, sidewalk = 63 • Encroachment permits, street = 31 Note that 1 permit could have a parklet, street and, sidewalk, or a combination of the 3 types; we count each type separately on each permit. Temporary or Permanent Parklet Program Given the uncertainty regarding when the pandemic will “end”, staff suggests Council to consider extending the temporary program through the end of 2021. This will allow restaurants to have expanded outdoor dining capacity during a time when transmission of COVID -19 may City of Palo Alto Page 10 still be a threat. Please note, if the pandemic continues to recede significantly, Council may be asked to consider a temporary ordinance before the sunset date. To aid the Council assessing whether or not to direct staff to develop a permanent program, staff have prepared a summary of pros and cons of a permanent parklet program. If Council directs staff to explore and develop a permanent program, the staff will return to Council with a draft program, receive feedback, and ultimately need Council approval. If Council is inclined to explore a permanent program further, staff suggest extending the temporary program until the exploration is exhausted. Table 6 summarizes some of the pros and cons of a permanent parklet program. Table 6: Pros and Cons of a Permanent Parklet Program Pro Con Enliven and enhance the pedestrian environment. Permitting public space to be used for private use. Compete with neighboring pedestrian- oriented areas in other communities. Decreases number of on-street parking spaces. Take advantage of great climate. Potential conflicts between neighboring businesses. Provide additional space for outdoor dining in case of future pandemics or seasonal viruses. Potential impediment to infrastructure repair and replacement. Adds a tool for city economic development support for local businesses, with associated cost recovery Requires staff time for permit review, inspection, and attendance to ongoing operational issues. Pros Parklets help enliven and enhance the pedestrian environment by providing more visual interest and decreasing the amount of space dedicated to motor vehicles. Parklets can be part of creating a lively pedestrian environment that attracts people. By attracting people, local business can thrive; these businesses serve local residents, provide tax revenue, and provide jobs. Parklets alone cannot create a dynamic pedestrian environment, but they can contribute. During the pandemic, many communities throughout the Bay Area created new opportunities for outdoor dining. While instituted as a survival mechanism in the face of the pandemic, these newfound opportunities are becoming permanent in other cities. Parklets can be part of Palo Alto remaining competitive, as compared to its neighbors. Trends show that as more consumers purchase goods online, the need to a ttract a critical mass City of Palo Alto Page 11 of people with disposable income relies on creating high -quality, pedestrian-oriented areas that are destinations. Patrons are seeking the experience of being out in public with their friends and family—fulfilling the desire people have to “see and be seen.” If Palo Altans cannot find that opportunity locally, they may head to neighboring communities that offer that experience. Providing the opportunity to dine outdoors can enhance the quality of the experience for shoppers and diners in Palo Alto, helping Palo Alto compete with neighboring communities and other pedestrian-oriented areas. Palo Alto’s pleasant climate makes outdoor dining possible many months of the year. Taking advantage of the weather through outdoor dining can bring enjoyment to local residents, while also attracting visitors. In areas of the city where the sidewalk is too narrow for sidewalk dining, parklets can allow for outdoor dining while maintaining a clear pedestrian path. A post-pandemic world remains months in the future. Further, it is not clear what to expect as COVID-19 draws to a close. Will future variants of the virus require development of more vaccinations? Will there be annual coronavirus vaccinations? Might future pandemics develop as the climate changes and humans live in closer contact with animals in many parts of the world? In the face of future variants or other viruses, what role will being outdoors play in reducing the risk of transmission? In the face of these and more questions, staff cannot say what role parklets will play. If, however, we assume that the coronavirus becomes seasonal, as many predict, then at certain times of year restaurants may need to pivot to outdoor dining. This could be due to mandates, best practices, the preferences of patrons—or all three. A permanent parklet program provides that flexibility. Cons A chief concern about parklets is that public land, on-street parking spaces, becomes associated with commercial enterprise. Communities with permanent parklet programs have dealt with this in different ways. Some communities require a parklet be available to any member of the public, not just patrons of a business. Staff would study this aspect of the program and return with more analysis. On one hand, having parklets open to all maintains the public nature of the right of way. On the other hand, the ability of parklet owners and operators to enable good visitor behavior may be limited more limited. For the privilege to use the public right of way, nearly all parklet programs charge a fee for the occupancy of the public space in recognition of its value. Staff would anticipate developing rental rates for the use of the parking space. Likewise, staff would also study and propose fees for permit review and program maintenance, in order to ensure the parklet owners fully cover the cost of the program. As Council considers whether or not public space should be occupied for private use, it is helpful to keep in mind that on-street parking spaces already represent public land reserved for City of Palo Alto Page 12 private use. That is, parking spaces are public land intended to be occupied by private vehicles. In the case of most on-street spaces in Palo Alto’s commercial districts, the occupancy of the public space by a private vehicle requires no compensation; on-street parking is free for 2 hours. A permanent parklet program would reduce the number of on -street parking spaces in Palo Alto. For many residents and businesses, a reduction in available parking spaces may be seen negatively. If the City is seeking to enhance the pedestrian environment and promote alternate modes of transportation, a reduction in on-street spaces may be seen positively. The temporary parklet program has demonstrated that not all businesses have the same perspective regarding parklets. Neighboring businesses may have conflicting perspectives. There are two primary types of neighbor conflict that have been observed during the temporary parklet program. The first conflict occurs when two restaurants are located ne xt door and front shared curb space. If both restaurants want to have a parklet, they would need to figure out how to collaborate and share the space equitably. Since change does occur over time, a new restaurant may be established that wants to share the curb space that is already occupied by a neighboring restaurant’s parklet. In such cases, staff recommend that when the permit term for the existing parklet expires (assuming there are relatively short-term parklet permit renewals) the existing parklet be modified to create space for the parklet of the neighboring restaurant. In fact, this type of conflict has occurred. If Council does extend the temporary parklet program beyond September 7, 2021, staff recommend Council also require that permits for existing parklets that are in front of another business, where the other business wants to use the space for their own parklet, would expire. Those parklets must be reduced in size to accommodate a neighboring parklet and the portion in front of the neighborin g business removed. The other type of conflict would be a retailer next to a restaurant that may not want the parklet to extend in front of the retail space. The restaurant, however, may only have sufficient space for a parklet if it includes the parking space in front of the retailer. While such conflicts have been rare during the temporary program, they highlight that parklets are not universally welcome. As businesses change over time, a parklet that met the needs of neighboring businesses may no longer be satisfactory for the new business. Navigating such conflicts will fall to City staff to manage. Parklets may impede repair and maintenance of infrastructure. Underground infrastructure, such as utility lines, and even the road surface beneath a par klet, may need to be accessed for repair and maintenance. While the City does not allow parklets to be placed over utility vaults, the need to access lines running underneath parklets may come up from time to time. Likewise, City of Palo Alto Page 13 repaving of roads may also require access to the area beneath the parklet. While these challenges are not insurmountable, they may require certain design standards that would allow a restaurateur to move a parklet during maintenance or otherwise provide access. Navigating these challenges requires advance planning and will also require additional time when repairs and maintenance are being scheduled and executed. Items to be Considered in a Permanent Parklet Program If Council provides staff direction to develop a permanent program, the following are some items that staff would research and propose regulations: - Design guidelines & rules, including where parklets are allowed, what type(s) of business can apply for a parklet, activities that can take place on a parklet , aesthetic considerations, etc. - Application, review, approval, and inspection processes for parklet plans. - Development of parklet rent and/or fees to cover staff time required for review, permitting, monitoring, value of the public land, and other costs. - A process to evaluate existing temporary parklets, and determine the modifications, renovations, redesign, or removal is necessary. This would address any design deficiencies observed during the temporary program. If directed to develop a permanent parklet program, staff anticipate returning to Council in the late summer or early fall. Summary of Key Issues & Policy Implications: Uplift Local Streets Program Key questions regarding the Uplift Local program: 1. How to support ground floor businesses in two core commercial areas? 2. How to support the local community in two core commercial areas? The California Avenue commercial area is fairly united in a desire to see the street remain closed to vehicular traffic. Most stakeholders, including businesses, landlords, and th e public, agree that the closure is providing a safer environment for activity during the pandemic. The closure supports both local businesses and provides an area for local residents to safely enjoy a sense of community. The Downtown and University Avenue have greater breadth of perspectives on the role the street closures play in providing relief from the pandemic. A premature reopening could have health impacts and diminish the viability of local businesses. Likewise, continued closure may threaten the viability of businesses who rely on vehicular access. While the CIP for University Avenue redesign is underway, immediate changes before May 31 are unlikely. City of Palo Alto Page 14 Staff suggest extending the authority for closures to occur; at a minimum staff recommend extending the closure period on California Avenue. Staff can commit to monitoring changes in the pandemic and the response from consumers. If a combination of indoor seating and parklet/sidewalk dining can accommodate demand, the streets may open again to vehi cular traffic. Likewise, should a surge occur during the time period covered by the resolution, the streets may close again. Parklets In regards to extending the temporary parklet program or allowing it to expire, the key issue is when the Council feels parklets may no longer be needed to respond to the pandemic. If Council feels confident that a new normal will have arrived by September 2021, then an extension may not be warranted. Looking at available information, staff believe much progress towards ending the pandemic will be made by September. Still, assuming that a new normal will have been established by September could be premature. Regarding the development of the permanent program, Council must consider how it wants to use the public curb space. Does Council prefer to see this space used for parking of private vehicles or for use by private businesses? Council may prefer to allocate some curb spaces to parklets, but establish overall limits. Council may prefer to see publicly accessible parklets established. Council may wish to return to the pre-pandemic status quo. If Council is interested in exploring a permanent parklet program, staff seek direction to research the topic and return with a proposed program for further, in-depth discussion. These topics can be more deeply explored at that time. Resource Impact: Execution of the Uplift Local and parklet programs requires a significant amount of staff time. While the outcome of this investment has not been measured, the City hopes the time spen t helps keep local businesses around to serve residents, to generate tax revenue and frontline jobs. The Uplift Local program involves the following City resources: • Weekly staff meetings • Bi-weekly meetings between staff and local businesses • Monthly community meetings • Public Works staff to place and maintain equipment for closures (water -filled barriers, signage, etc) • Printing and design of posters, signage, banners, and barrier covers • Day-to-day problem solving with individual businesses or incidents as they occur • Review of no-fee encroachment permits for placement of tables, chairs, and other City of Palo Alto Page 15 private items in the public street or on sidewalks The temporary parklet program involves the followng City resources: • Weekly staff meetings • Bi-weekly meetings between staff and local businesses • Monthly community meetings • Day-to-day problem solving with individual businesses or incidents as they occur • Review of submitted plans and drawings by Public Works, plan check engineers, Fire plan check, and other departments as appropriate • Issuance of no-fee encroachment permits • Inspection of parklets to ensure safety • Inspections, warnings, and citations to achieve compliance with stated rules and guidelines Timeline: Staff seek Council’s direction in advance of the expiration dates. The Uplift Local program currently ends on May 31, 2021. The temporary parklet program expires September 7, 2021. Stakeholder Engagement: The City has engaged local stakeholders on both the street closure and parklet program since their inception. The City hosts a bi-weekly meeting with Cal Ave and a separate meeting with Downtown businesses. In addition, staff are available for 1:1 consultation and assistance with problem solving. Stakeholders also send written correspondence to staff as well as Council. Staff also conduct counts of visitors to Uplift Local streets; some counts are not completed if staff are not available. The counts provide an objective measure of participation in Uplift Local Streets. In addition, the City hosts a monthly community engagement meeting. While attendance at this meeting varies, it has been a consistent tool to disseminate information and get feedback from interested community members. In the early days of the pandemic, local residents expressed a high degree of interest in the street closure topic, with hundreds writing to Council to support closures and later answering an online survey. Staff continues to maintain a website and webpages dedicated to these programs for public information and to support busines ses who are interested in these program opportunities to expand outdoor activities. Environmental Review: Approval of the resolution as recommended is statutorily exempt from environmental review under the California Environmental Quality Act (CEQA) pursuant to Public Resources Code Section 20180(b)(4) (specific actions necessary to mitigate or prevent an emergency) and is City of Palo Alto Page 16 categorically exempt from CEQA under CEQA Guidelines Sections 15301 (existing facilities) and 15304(e) (minor temporary use of land having negligible or no permanent effects on the environment). Attachments: Attachment A: Resolution to Extend the Temporary Closures of Portions of California Ave and University Ave and Certain Downtown Streets Intersecting University Ave As First Authori zed by Reso 9099 (PDF) Attachment B: Uplift Local Street Closure Map (PDF) *NOT YET APPROVED* 0224_20210317_ts24 1 Resolution No. _____ Resolution of the Council of the City of Palo Alto Amending and Restating Resolution No. 9933 to Extend the Temporary Closures of Portions of California Avenue and University Avenue and Certain Downtown Streets Intersecting University Avenue Pursuant to California Vehicle Code Section 21101, and to Extend the Effective Date of Resolution No. 9909, All Pursuant to the Local Emergency Declaration to Facilitate Outdoor Dining, Retail, and Other Uses R E C I T A L S A. On June 23, 2020, the Council adopted Resolution No. 9909 approving the temporary closure of portions of California Avenue, University Avenue and certain other Downtown streets through Labor Day 2020 to allow for outdoor dining and retail on those streets, consistent with the Santa Clara County Public Health Order in effect. The street closures were part of a Summer Streets Program initiated by the City to accommodate outdoor uses at a time when indoor dining remained prohibited in the County and the growing scientific evidence showed a lower risk of COVID‐19 transmission outdoors compared to indoors. At that time, the City anticipated that indoor dining would be allowed to resume in the County, as had been allowed in neighboring counties, and sought to address the immediate needs of the community including residents, workers and businesses that had been severely impacted by loss of business activity and revenue. B. Through Resolution No. 9909 the Council also approved a temporary pilot parklet program to allow parklets to be installed in on‐street parking spaces on an expedited and temporary basis to provide more space for outdoor dining. C. On July 2, 2020, the County Public Health Officer issued a revised Shelter in Place Order, to become effective on July 13, 2020, that allowed certain additional activities to resume if specified strict across‐the‐board risk reduction measures were followed. The objective was to allow activities that were already allowed in surrounding jurisdictions, which had reopened more quickly than Santa Clara County, so long as the prescribed risk reduction measures were followed. D. On July 7, 2020, the State approved Santa Clara County’s requested variance that allowed the revised Shelter in Place Order to go into effect on July 13, 2020. E. However, with the number of COVID‐19 cases dramatically increasing again in the State, on July 13, 2020, the Governor announced a sweeping roll back of the reopening that the State had allowed. The State mandated that all counties close certain indoor operations, including in‐restaurant dining. For counties on the State’s monitoring list for 3 consecutive days (and thus placed on the State “watchlist”), the State required the closure of additional industries or activities unless they could be modified to operate outside or by pick‐up; these included gyms and fitness centers, places of worship and cultural ceremonies, personal care services, hair salons and barbershops, and shopping malls. *NOT YET APPROVED* 0224_20210317_ts24 2 F. Through the summer, the United States including “hot spots” like California continued to hit new highs in confirmed cases and deaths, as the loosening of shelter‐in‐place restrictions had precipitated a resurgence of the virus in many states, including California. As of July 27, 2020, the State was averaging nearly 10,000 new COVID‐19 cases per day, and hospitals and their intensive care units were filling up. Thirty‐seven counties representing 93% of the State’s population were on the State’s watchlist, and California had 460,550 confirmed cases of COVID‐19, resulting in 8,445 deaths. G. On August 10, 2020, the Council adopted Resolution No. 9911, which amended Resolution 9909, to extend until December 31, 2020 the temporary closure of portions of California Avenue and University Avenue and certain intersecting streets to allow for continued use of these areas in the heart of the City’s commercial districts to allow for outdoor dining and potentially other activities as may be allowed by State and County Public Health Orders. Resolution No. 9911 also extended the temporary parklet program to September 7, 2021. H. Since August 2020, the County Public Health Officer issued a Risk Reduction Order on October 5, 2020, which coincided with the County moving into the orange tier under the State’s “Blueprint for a Safer Economy” tiered restriction system. I. However, on November 16, 2020, the State moved Santa Clara County two steps from the orange/moderate tier to the purple/widespread tier (the highest risk tier) due to a sharp increase in COVID‐19 cases statewide. On that date, the County reported 388 new cases of COVID‐19, bringing the cumulative total to 28,686. As of November 17, 2020, California reported 1,029,235 confirmed cases of COVID‐19, resulting in 18,263 deaths, and 94.1% of the State’s population was now in the purple tier (according to the Governor’s Office). The State’s rules for the purple/widespread tier mandate that restaurants and gyms cannot have indoor service and retail stores may only have 25% capacity indoors. J. On December 14, 2020, the Council adopted Resolution 9933, which amended Resolution 9099, to extend until May 31, 2021 the temporary closure of portions of California Avenue and University Avenue and certain intersecting streets to allow for continued use of these areas in the heart of the City’s commercial districts to allow for outdoor dining and potentially other activities as may be allowed by State and County Public Health Orders. K. On March 3, 2021, the State moved Santa Clara County one step down from the purple/widespread tier to the red/substantial tier. As of March 16, 2021, the County reported a cumulative total of 112,909 COVID cases and 1,867 deaths. L. In the midst of this continued COVID‐19 pandemic, the City of Palo Alto has continued to take measured steps to allow businesses to resume activities in outdoor settings. As a key part of those efforts, the Uplift Local Program (formerly known as the Summer Streets Program) has created an attractive pedestrian environment on the closed streets resulting in increased foot traffic. A number of restaurants have taken advantage of the program and created *NOT YET APPROVED* 0224_20210317_ts24 3 outdoor seating in the streets, on sidewalks, and on parklets. Residents and visitors who have come to University Avenue and California Avenue have expressed delight and reported having a highly enjoyable experience. M. The current pace of re‐opening across the State and the high likelihood that the pandemic will continue into 2021 increase the chances that outdoor dining is a key tool to reduce the risk from the spread of COVID‐19 while allowing restaurants to continue some operations. Even if indoor dining is allowed, patrons may be unwilling to participate, or the opportunity may be rescinded if the County exceeds the COVID indicator thresholds issued by the State. N. The Council desires to extend the street closures through September 7, 2021 to allow for the continued use of the main thoroughfares in the heart of its commercial districts for outdoor dining, and potentially other activities as may be allowed by the State and County Public Health Orders. NOW THEREFORE THE CITY COUNCIL OF THE CITY OF PALO ALTO RESOLVES AS FOLLOWS: SECTION 1. Findings and Declarations. The Council hereby adopts the above Recitals as findings of the Council. SECTION 2. Extension of Temporary Street Closures. The Temporary Street Closures approved and authorized in Section 2 (Temporary Street Closures) of Resolution No. 9909 and extended by Resolutions 9911 and 9933 are hereby extended through September 7, 2021. Section 2 of Resolution No. 9909 is amended to read as follows: Temporary Street Closures A. The following streets are hereby closed to any and all vehicular traffic through September 7, 2021, in accordance with California Vehicle Code Section 21101(e), to facilitate the temporary uses of outdoor dining, retail, and other permitted uses: 1. California Avenue from Birch Street to El Camino Real; and 2. University Avenue from High Street to Cowper Street, with continued vehicular access across University Avenue at each of the intersecting streets. B. The City Manager is authorized to determine the days, hours and duration of the temporary street closure(s) within the period specified in Section A, with reasonable notice provided, and whether exceptions to the closure shall be made for municipal purposes. *NOT YET APPROVED* 0224_20210317_ts24 4 SECTION 3. Sunset of Resolution No. 9909. Resolution No. 9909 shall remain in effect until September 7, 2021, unless extended by the City Council. SECTION 4. Supersedes Resolutions 9911 and 9933. This Resolution shall supersede Resolutions No. 9911 and 9933. Should any conflict arise between this Resolution and Resolutions No. 9911 and 9933, this Resolution shall control. SECTION 5. The Council finds that this Resolution is statutorily exempt from environmental review under the California Environmental Quality Act (CEQA) pursuant to Public Resources Code Section 20180(b)(4) (specific actions necessary to mitigate or prevent an emergency) and is categorically exempt from CEQA under CEQA Guidelines Sections 15301 (existing facilities) and 15304(e) (minor temporary use of land having negligible or no permanent effects on the environment). SECTION 6. This Resolution shall become effective immediately upon adoption. INTRODUCED: PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: __________________________ _____________________________ City Clerk Mayor APPROVED AS TO FORM: APPROVED: __________________________ _____________________________ Deputy City Attorney City Manager _____________________________ Director of Public Works _____________________________ Chief Transportation Official = Street Closed = Closure Authority University Avenue Uplift Local = Street Closed = Closure Authority California Avenue Uplift Local City of Palo Alto (ID # 11898) City Council Staff Report Report Type: Informational Report Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: Energy Risk Management First Half (First and Second Quarters) of FY 2021 Title: City of Palo Alto's Energy Risk Management Report for the First Half of Fiscal Year 2021 From: City Manager Lead Department: Administrative Services Recommendation This is an informational report and no City Council action is required. Executive Summary Staff continues to purchase electricity and gas in compliance with the City’s Energy Risk Management Policies, Guidelines, and Procedures. This report is based on market prices and load and supply data as of December 31, 2020, the end of the first half of Fiscal Year (FY) 2021. The projected cost of the City’s fixed-price electricity purchases is $1.16 million higher than the market value of that electricity as of December 31, 2020 for the 12-month period beginning January 1, 2021. In the first half of FY 2021 (July 1, 2020 through December 31, 2020) the City’s credit exposure to fixed price contracts is minimal. The projected Electric Supply Operations Reserve is above the FY 2021 minimum guideline reserve level and the projected gas reserve is also above the FY 2021 guideline reserve level range. There were no exceptions to the Energy Risk Management Policies, Guidelines, or Procedures during the first half of FY 2021. Background The purpose of this report is to inform the Council about the status of the City’s energy portfolio and transactions executed with energy suppliers as of the end of the first half of FY 2021. The City’s Energy Risk Management Po licy requires that staff report on a quarterly basis but due to lower trading activity levels the Utility Risk Oversight Coordinating Committee (UROCC) has approved providing this report on a semi-annual basis to Council on: 1) the City’s energy portfolio; 2) the City’s credit and market risk profile; 3) portfolio performance; and 4) other key market and risk information. City of Palo Alto Page 2 The City’s Energy Risk Management Policy describes the management organization, authority, and processes to monitor, measure, and contro l market risks. “Market risks” include price and counterparty credit risk. These are risks that the City is exposed to on a regular basis in procuring electric supplies, and to a lesser extent for gas supplies, which are purchased at market rates via a monthly index price. The City’s Energy Risk Management staff are located in the Treasury Division of the Administrative Services Department. Their role is to monitor and mitigate these risks. This first half of FY 2021 Energy Risk Management Report contains information on the following: • Electric Supplies • Hydroelectricity • Fixed-Price Forward Electricity Purchases • Gas Supplies • Credit Risk • Electric Forward Mark-to-Market Values • Electric and Gas Supply Operations Reserves Adequacy • Exceptions to Energy Risk Management Policies, Guidelines, or Procedures Discussion Electric Supplies In order to serve the City’s electric supply demands, the City obtains electricity from: hydroelectric resources (from Western and Calaveras Hydroelectric Projects); long -term renewable energy contracts (from landfill gas converted to electricity, wind, and solar projects); wholesale purchases which are carried out via fixed-priced forward market purchase contracts; and the electric spot market. Figure 1 below illustrates the projected sources and expected purchases of electricity supplies by month for the 36 months from January 1, 2021 to January 1, 2024, in megawatt -hours (MWh). The negative bars represent sales of excess power on the wholesale market. City of Palo Alto Page 3 -40,000 -20,000 0 20,000 40,000 60,000 80,000 100,000 120,000 140,000 160,000 Ja n - 2 1 M a r - 2 1 M a y - 2 1 Ju l - 2 1 Se p - 2 1 N o v - 2 1 Ja n - 2 2 M a r - 2 2 M a y - 2 2 Ju l - 2 2 Se p - 2 2 N o v - 2 2 Ja n - 2 3 M a r - 2 3 M a y - 2 3 Ju l - 2 3 Se p - 2 3 N o v - 2 3 Me g a w a t t H o u r s Figure 1 -Electric Balance Wind Wholesale Western Solar Landfill Calaveras Total Load Hydroelectricity The cost of hydroelectricity received from Western over the 12-month period ending December 31, 2020 is more than the market value of electricity by $1.7 million. Hydroelectric power from Calaveras was expected to cost $9.4 million (as of December 31, 2020) more than the market value of electricity. Note that Calaveras provides benefits not reflected in the mark -to-market (MTM, defined in the following section) calculation, including, for example, ancillary services (e.g., the ability to regulate energy output when the electric grid needs change), and that much of the above-market costs are related to debt service on the cost of constructing the dam. This debt is due to be retired in 2032, and retirement will substantially improve the value of the project relative to the market price of electricity. Fixed-Price Forward Electricity Purchases The City, as of December 31, 2020, has purchased and sold fixed-priced supplies of electricity for the next 12 months totaling 29,480 MWh with an average price of $63.13 per MWh and totaling 103,200 with an average price of $40.65, respectively. The City contracted for these purchases with three of its approved counterparties: SENA (Shell Energy North America), BP, and NextEra Energy Resources. The 12-month MTM value of the City’s forward transactions for wholesale power was $1.16 million at the end of the first half of FY 2021. A positive MTM means that the sales price for these transactions was lower than the market value as of December 31, 2020. The City tracks the mark to market value of its forward contracts to City of Palo Alto Page 4 measure the value that would be lost due to a counterparty failing to deliver on its contractual commitments, forcing the City to purchase replacement electricity in the market. The exposure listed above is well within risk management guidelines and presents little risk to the City’s financial outlook. The figures below represent the electric forward volumes (Figure 2) and MTM positions (Figure 3) for each electric supplier by month of delivery for all forward fixed-price electricity contracts over the 12-month period ending December 31, 2021. During the report period, there’s no purchases from September to December 2021. -30,000 -20,000 -10,000 0 10,000 20,000 30,000 40,000 01 / 0 1 / 2 1 02 / 0 1 / 2 1 03 / 0 1 / 2 1 04 / 0 1 / 2 1 05 / 0 1 / 2 1 06 / 0 1 / 2 1 07 / 0 1 / 2 1 08 / 0 1 / 2 1 09 / 0 1 / 2 1 10 / 0 1 / 2 1 11 / 0 1 / 2 1 12 / 0 1 / 2 1 Me g a w a t t H o u r s Figure 2 -Electric Forward Volumes ending as of 12/31/21 BP SENA NextEra Energy Resources City of Palo Alto Page 5 (2,000,000) (1,500,000) (1,000,000) (500,000) - 500,000 1,000,000 1,500,000 Ja n - 2 1 Fe b - 2 1 M a r - 2 1 Ap r - 2 1 M a y - 2 1 Ju n - 2 1 Ju l - 2 1 Au g - 2 1 Se p - 2 1 Oc t - 2 1 No v - 2 1 De c - 2 1 MT M D o l l a r A m o u n t Figure 3 -Electric Mark-to-Market Values ending as of 12/31/21 BP SENA NextEra Energy Resources Gas Supplies In order to serve the City’s natural gas needs, the City purchases gas on the monthly and daily spot markets. The City purchases all of its forecasted gas needs for the month ahead at a price based on the published monthly spot market index price for that month. Within the month, the City’s gas operator buys and sells gas to match the City’s daily needs if the actual daily usage is different from the forecasted daily usage. Those daily transactions are made at an average price based on the published daily spot market index. These costs are passed through directly to customers using a monthly rate adjustment mechanism, leaving the City with little or no price risk or counterparty risk exposure for the gas utility. After this report period, Natural gas prices rose significantly in February 2021 because of some extreme weather in Texas. The City buys most of its gas at Malin, Oregon from gas pipelines coming from the Northwest, where the price rises were less severe. The high prices were temporary and occurred for a limited number of days within the month. The City’s hedging strategy protects against these intra-month price rises, but where the City’s forward purchases do not exactly match the City’s load (which is typical), the City can experience some impact from the price increases. The City uses reserves to absorb those impact s. Credit Risk Staff monitors and reports on counterparty credit risk based on the major credit rating agencies (S&P and Moody’s) scores, Ameresco has a 0.10 percent Expected Default Frequency (EDF) City of Palo Alto Page 6 which is higher than the recommended EDF level of .08 percent. The EDF has improved, the prior year it was 0.25 percent and, as of writing of this report, (March 26, 2021), the EDF is 0.31 percent. Staff is continuing to monitor Ameresco’s EDF and will continue to report to City Council in this semi-annual report. Table 1 below shows the EDF values for the City’s renewable energy counterparties. Table 2 below shows the EDF values and credit exposure for the City’s electric suppliers. There is virtually no credit exposure to the City’s gas suppliers since the supplies are purchased on a short-term basis. Table 1 - Renewable Counterparties Credit Ratings and EDFs as of 12/31/20 Current Expected Default Frequency Moody's (EDF) Implied Rating Ameresco 0.10%Ba3 0.03%A2 Source: CreditEdge website Renewable Counterparty Avangrid (fomerly Iberdrola) Table 2 - Credit Exposure and Expected Default Frequency of Electric Suppliers as of 12/31/20 Electric Counterparty Cost of Transaction Market Value of Transaction Current Expected Default Frequency Moody's (EDF) Implied Rating Exelon -$ -$ NextEra 307,020 296,528 0.010%Aaa SENA (2,893,080) (4,067,166) 0.101%Baa3 BP 252,000 250,800 0.091%Baa3 Totals (2,334,060)$ (3,519,838)$ (1) (10,492) 1,162,394$ (1)$ Cost vs. Market (MTM) Value S & P C r e Expected Loss (MTM x Expected Default Frequency) 1,174,086 AA-- (1,200) (1) A- -$ BBB -$ Electric Forward Mark-to-Market Values It is important to note that, for contracts with renewable energy companies, Council waived the investment grade credit rating requirement of Section 2.30.340(d) of the Palo Alto Municipal Code, which applies to energy companies that do business with the City. In addition, the City does not pay for renewable energy until it is received, thereby reducing risk. BP and SENA EDF have declined compared to the prior report. According to BP’s 2020 financial report “demand for energy is closely linked to human activity” referring to the impact of the COVID-19 pandemic on their financials. SENA echoed a similar sentiment. As of writing of the report, BP’s EDF as of April 5, 2021 is 0.065 percent and SENA’s is .067 percent; an improvement over what’s reported in Table 2. City of Palo Alto Page 7 An EDF of 0.08% or below indicate supplier’s current expected default frequency falls within the investment grade range. An EDF above 0.08% indicates the supplier may have financial issues that require monitoring. Electric and Gas Supply Operations Reserves Adequacy As shown in Table 3 below, the Electric Supply Operations reserve’s unaudited balance as of December 31, 2020 is $47.4 million, which is $22.2 million above the minimum reserve guideline level. The audited Gas Operations reserve balance is $10.1 million, which is $4.3 million above the minimum reserve guideline level. Table 3 - Electric Supply Operations and Gas Operations Reserve Levels for FY 2021 Fund Audited Reserve for Operations Balance as of 06/30/2020 ($ Millions) Changes to the Reserves for Operations ($ Millions) Unaudited Reserve for Operations Balance as of 12/31/20 ($ Millions) Minimum Guideline Reserve Level ($ Millions) Maximum Guideline Reserve Level ($ Millions) Electric $38.5 $8.9 $47.4 $25.2 $46.9 Gas $13.4 ($3.3)$10.1 $5.8 $11.7 FY 2021 Exceptions to Energy Risk Management Policies, Guidelines, or Procedures There were no exceptions to the Energy Risk Management Policies, Guidelines, or Procedures to report during the first half of FY 2021. City of Palo Alto (ID # 12065) City Council Staff Report Report Type: Informational Report Meeting Date: 4/19/2021 City of Palo Alto Page 1 Summary Title: PAFD Semi -Annual Performance Report FY21 Title: Palo Alto Fire Department Semiannual Performance Report for the First Half of Fiscal Year 2021 From: City Manager Lead Department: Fire Recommendation Staff recommends the City Council review the First Palo Alto Fire Department Semi- Annual Performance Report for Fiscal Year 2021. Background and Discussion In Fiscal Year 2015 the Palo Alto Fire Department (PAFD) identified performance reporting as a key initiative and began reporting on key per formance measures quarterly. In Fiscal Year 2018 the Department began submitting reports twice each year. The report provides overall calls for service information, as well as more detailed information on the key service areas, including Emergency Medic al Services, Fire Suppression, Rescue and Hazardous Materials Response, and Fire Prevention. The report also provides information on mutual and automatic aid with our regional public safety partners and internal workforce planning efforts. Performance measures include the following: • Calls for Service: This data provides information on the final outcome of all emergency response calls. The data is tracked in the Fire Department’s Record Management System, and uses standardized call type codes, which are defined by the National Fire Incident Reporting System (NFIRS). The report includes overall call volume by primary category, and a detailed listing of call type in the service type sections. • Response Times: The time that an alert is received from the emergency dispatchers to the arrival of the fire resources at the scene of the emergency. City of Palo Alto Page 2 This information is tracked in the Computer Aided Dispatch (CAD) System, and the performance goals, or service levels, are set by Council in accordance with county and national standards. • Ambulance Transports: The report provides the number of ambulatory transports to hospitals or other medical care facilities, and the proportion of Emergency Medical Calls that included transports. This information is tracked in the Fire Department’s Emergency Medical Record Management System. • Fire Containment: This measures the proportion of building and structure fires that are contained to the area or room of origin within Palo Alto and Stanford Campus. • Mutual and Automatic Aid: This includes the number and proportion of all incidents that the PAFD provided aid to neighboring communities, as well as the aid received from neighboring Fire Departments. This information is tracked in the CAD System. • Permits: This provides the total count of facility, electric vehicle, and solar permits issued by the Fire Prevention Bureau. This information is currently tracked in the Development Center’s Records Management System. • Inspections: A count of the total number of Hazardous Materials and State Mandated inspections is provided. In addition, an estimated number of inspections to be completed for the year is also provided to assess overall workload performance to date. • Fire and Life Safety Plans Reviewed: This provides a total count of all p lans reviewed, as well as the proportion of plans that were reviewed within the time guidelines. • Vacancies and Off-Line Employees: This section provides the total number of budgeted full-time equivalent shift personnel, current vacancies, and employees that are off-line due to workers compensation or light duty. This information is obtained from the Fire Department’s Staffing and Scheduling System (TeleStaff), as well as the City’s Personnel Management System. • Succession Planning Metrics: This provides the number and proportion of shift personnel that are eligible to retire, or will be eligible within the next five years. This information is tracked in the City’s Personnel Management System. This report also provides the total number of hours that shift personnel spent in an acting capacity. Personnel serving in an acting capacity are a key component of the Department’s overall succession planning efforts. Acting capacity allows junior officers to learn the responsibilities of higher ranks with guidance from City of Palo Alto Page 3 senior officers. This information is tracked in TeleStaff. • Training hours: The total number of training hours completed by all shift personnel is provided, as well as the average number of hours per each shift personnel on staff. This information is tracked in the Fire Department’s Record Management System. Local, State and Federal mandates require fire personnel to train a minimum of 20 hours per month. Attachments: • ATTACHMENT A_Coverletter • ATTACHMENT B_Semi Annual Performance Report FY21.1 FINAL • ATTACHMENT C_EMS Survey Report • ATTACHMENT D_Kudos City of Palo Alto Fire Department Honorable Councilmembers, Enclosed is the performance report for the first half of Fiscal Year 2021 (July 2020 through December 2020), and we have continued to see a significant change in our service demands and operations this period as a result of the Coronavirus pandemic. Overall call volume decreased by eighteen percent (18%) from the same period in Fiscal Year 2020. All call types decreased with the exception of Fire Calls, which increased by twenty-six percent (26%) from the prior year, and Hazardous Material Calls that were up by forty-eight percent (48%). The fiscal crisis caused by the Coronavirus Pandemic required the department to eliminate eight sworn Firefighter positions in Operations and Fire Prevention. With a collaborative effort from the City and Council, we were able to create these eliminations through attrition. As of February, we only have one position remaining and it is likely we will be able to eliminate this position through attrition and avoid any layoffs. This time also saw some of the most destructive fires in California, including the SCU Lightening and LNU Lightening Complex fires on the Peninsula and in the South Bay. This fire season we sent strike teams to twelve fires for a total of 104 days, the most in the recent history of the Palo Alto Fire Department. Fire season continues to grow longer with weather changes, and it is expected that trends will continue with fires growing in intensity each year in California. Sincerely, Geo Blackshire Fire Chief Palo Alto Fire Department First Semi-Annual Performance Report Fiscal Year 20 21 Highlights ➢ 18% reduction in call volume from previous year due to Coronavirus Pandemic Shelter in Place ➢ EMS Incidents accounted for 58% of all calls, totaling 2,120 ➢ Response time goals for EMS calls were met ➢ Fire Response times and containment continue to not meet goals ➢ 26% increase in fire incidents ➢ 48% increase in hazardous material incidents ➢ The Fire Prevention Bureau completed less Inspections due to reduced staffing and had a longer completion rate for plan check. ➢ Eliminated 7 of the 8 Sworn Positions identified for budget reductions through attrition Fire Station 2 Brown Out In response to the economic recession brought on by the Coronavirus pandemic, 5.0 FTE Line Firefighter positions were frozen and Fire Station 2 (College Terrace) was browned out. A brown-out is when a fire station is temporarily shut down. When fire suppression takes leave from a shift, i.e. sick leave, vacation, etc. the engine/ambulance is temporarily taken out of service to compensate for budget shortfalls instead of filling that vacancy with overtime personnel. Fire Station 2 is browned-out weekdays from 8:00 PM to 8:00 AM and on weekends. The table below shows the number of days in each month that Station 2 was shut down, beginning on August 1, 2020: Month Count of Days Percentage August 29 94% September 22 73% October 30 97% November 26 87% December 27 87% 5 Month Total 134 88% When Fire Station 2 is browned-out, response times into this district are increased as fire engines and ambulances from other districts are the first-due units for emergencies in Station 2’s response area. Engine 62 typically responds to 62 calls per month on average, when in service full time. As a result of the brown out, Engine 62 has missed approximately 44 calls each month. In each of these emergency calls for service, another Engine or Unit must be dispatched from a further location increasing the response time to the call. From August to December 2020 the 90th percentile travel time in the Fire Station 2 area increased by an average of 31 seconds when compared to travel times from January to July 2020. There have been several significant fires that Fire Station 2 units did not respond to during the brown-out period including a 3 acre grass fire at the Stanford Dish. Engine 62 did respond to a few fires that occurred when in service, including a 2nd alarm Electrical fire, and a 2nd alarm residential fire that displaced the occupants. PAFD FY20 Bi-Annual Performance Report 2 | P a g e Calls for Service The Palo Alto Fire Department (PAFD) responded to a total of 3,678 calls for service in the first six- month period of Fiscal Year 2021. This includes responses within Palo Alto, Stanford, and neighboring cities to provide Automatic Aid and Mutual Aid. Approximately eighty-seven percent (87%) of calls are generated from Palo Alto, eleven percent (11%) from Stanford, and the remainder, from neighboring cities or requests for regional and statewide resource requests. The majority of calls were for Rescue and Emergency Medical Services, making up fifty eight percent (58%) of the responses. The table below shows the main categories of the calls to which PAFD responded. Call types are classified based on the outcome of the call and not necessarily the call type reported in the initial dispatch. Call Type FY20 JUL-DEC FY21 JUL-DEC Rescue and Emergency Medical Services Incidents 2,792 2,120 Good Intent 666 610 False Alarm and False Call 601 494 Service Call 312 277 Hazardous Condition, No Fire 71 105 Fire 57 72 Grand Total 4,499 3,678 Good Intent and False Alarm calls make up the second largest types of responses. Calls for service that may be thought to be a true threat of fire, gas, or other emergency hazard are actually found to be nonemergent after Firefighters investigate the situation. These calls are coded as Good Intent calls. As well, many fire alarm activations are from causes other than fires or emergency hazards. These situations are categorized as False Alarm calls. PAFD FY20 Bi-Annual Performance Report 3 | P a g e Emergency Medical Services and Rescue Emergency Medical Service (EMS) is the primary service that the Palo Alto Fire Department provides to Palo Alto and Stanford. While this shift toward EMS is being seen across the industry, the Palo Alto Fire Department is the only Fire Department in the County that operates its own ambulance transport services. Of the 2,120 Emergency Medical Service calls the PAFD responded to in the first period of Fiscal Year 2021, the overwhelming majority were for medical, trauma and cardiac emergencies that did not involve a vehicle accident. Rescue and EMS Performance Measures FY20 JUL-DEC FY21 JUL-DEC Emergency Medical Service Incident 2,729 2,097 Extrication, Rescue 54 19 Lock-In 4 2 Rescue or EMS Standby 4 1 Water and Ice-Related Rescue 1 1 Total 2,792 2,120 Transports Number of Transports 1,958 1,502 Percent of EMS Calls resulting in transport 70% 71% Response Times Percent of first responder arriving on scene to EMS calls within 8 minutes 91% 90% Percent of paramedic responder arriving on scene to EMS calls within 12 minutes 99% 99% Average response time for first responder arriving on scene to EMS calls 5:14 5:46 This period reflects a slight decrease to the number of Rescue and EMS Incident calls. The number of EMS calls that resulted in an ambulance transport to a local hospital or care facility, accounted for seventy one percent (71%) of all EMS calls. This is the primary source of revenue generated from emergency medical services, and the Department has seen a small decline to revenue from the decrease of EMS calls over the last period.  Response Time Goal Met: At least 90% of first responder arriving on scene to EMS calls within eight minutes. This period the PAFD first responder arrived on scene to EMS calls within eight minutes, ninety percent (90%) of the time.  Response Time Goal Met: At least 99% of paramedic responder arriving on scene to EMS calls within 12 minutes. This period the PAFD paramedic responder arrived on scene to EMS calls within 12 minutes ninety-nine percent (99%) of the time. PAFD FY20 Bi-Annual Performance Report 4 | P a g e Fire Suppression Very few of the potential fire calls coming into dispatch turn out to be a real fire once PAFD investigates the scene and cause of the concerning elements. This period PAFD responded to seventy- two (72) calls where fire was present, with fifty-four in Palo Alto and five that occurred on Stanford Campus. There were seven (7) building fires that the Department responded to where 71% of which were contained to the area of origin. Significant fires for this period are: 7/30/20: Small fire in building under construction. Fire contained to area of origin 8/10/20: Brush fire involving car port. Confined to carport and contents. 9/15/20: Exterior fire that extended into the interior of the property. Fire spread through the walls to the attic of the two-story structure 11/10/20: Fire in mechanical space between first and second floor on Stanford Campus. 11/19/20: Fire in public parking garage. Fire contained to materials involved, no structural involvement Fire Suppression Measures FY20 JUL-DEC FY21 JUL-DEC Structure Fire 18 19 Outside rubbish fire 8 18 Natural vegetation on fire 6 12 Fire, Other 5 12 Special outside fire 14 5 Mobile property (vehicle) fire 6 4 Fire in mobile property used as a fixed structure - 2 Total 57 72 Response Times Percent of first responder arriving on scene to Fire calls within 8 minutes 86% 88% Average response time for first responder arriving on scene to Fire calls 5:48 5:54 Fire Containment Percent of building and structure fires contained to the room or area of origin 71% 71%  Response Time Goal Not Met: At least 90% of first responder arriving on scene to Fire calls within eight minutes. This period the PAFD first responder arrived on scene to Fire calls within eight minutes eighty-eight percent (88%) of the time.  Fire Containment Goal Not Met: At least 90% of building and structure fires contained to the room or area of origin. This period, there were six building or structure fires within Palo Alto or Stanford, of which seventy one percent (71%) was contained to the room or area of origin. PAFD FY20 Bi-Annual Performance Report 5 | P a g e Hazardous Materials The Fire Department responded to a total of 104 calls related to hazardous material incidents. The number of biological hazards significantly increased due to the Coronavirus Pandemic. A portion of the forty-seven (47) responses were from decontamination calls from exposure to the virus. Hazardous Materials Response Measures FY20 JUL-DEC FY21 JUL-DEC Biological hazard 3 47 Combustible/Flammable spills and leaks 44 22 Electrical wiring/Equipment problem 15 20 Hazardous Condition, Other - 5 Chemical release, reaction, or toxic condition 5 4 Accident, potential accident 3 3 Attempted burning, illegal action 1 3 Total 71 104 Response Times Average response time for first responder arriving on scene to Rescue & Hazardous Materials calls 6:40 6:24 PAFD FY20 Bi-Annual Performance Report 6 | P a g e Mutual and Automatic Aid The Fire Department previously held automatic aid agreements with five regional Fire Departments, including Mountain View, Menlo Park, and Santa Clara County Fire. At the request of the City of Mountain View, the automatic aid agreement was modified at the beginning of January 2018 . The Palo Alto Fire Department continues to advocate for the closest unit response and co llects objective data to support improved services to all of our communities under the previous automatic aid agreement. Santa Clara County received the highest amount of aid from the Department this period accounting for forty-four percent (44%) of all mutual and auto aid provided. The Department received the most aid from Mountain View with a total of 20 incidents. Mutual Aid Performances FY20 JUL-DEC FY21 JUL-DEC Mutual and Auto Aid Provided Agency Santa Clara County Fire 33 25 Mountain View Fire 15 13 Menlo Park Fire 4 7 San Mateo County 2 4 Strike Teams 0 6 Other 0 2 All Mutual and Auto Aid Provided 57 57 Mutual and Auto Aid Received Agency Mountain View Fire 36 20 Menlo Park Fire 16 10 Santa Clara County Fire 1 7 Woodside 10 6 Santa Clara City 3 Sunnyvale - 2 All Mutual and Auto Aid Received 63 48 PAFD FY20 Bi-Annual Performance Report 7 | P a g e Fire Prevention The Fire Prevention Bureau ensures compliance with the Fire Code for the safety of occupants and protection of property. Fire Inspectors perform fire sprinkler and fire alarm plan checks, permitting, and field inspections with the goal of ensuring all construction complies with local, State, and national fire codes. This period saw a decrease in the number of inspections and in plans reviewed on time due to a thirty- three percent (33%) reduction in staff in alignment with lower estimated revenue activities from the Coronavirus pandemic. Prevention Bureau Performance Measures FY20 JUL-DEC FY21 JUL-DEC Permits Fire Permits Issued 214 166 Sprinkler Permits Issued 157 97 Solar Permits Issued 93 162 Electric Vehicle Permits Issued 0 0 Inspections Fire Inspections 5,288 3,836 Hazardous Material Inspections Completed 139 20 Number of Hazardous Material Inspections for the year 700 716 Percent of Hazardous Material Facilities Inspections Complete 20% 3% State Mandated Inspections Completed 332 390 Number of State Mandated Inspections for the year 517 532 Percent of State Mandated Facilities Inspections Complete 62% 73% Fire and Life Safety Plan Review Plans Reviewed 1,000 1,000 Percent of Reviews Completed On-Time 93% 88% PAFD FY20 Bi-Annual Performance Report 8 | P a g e Workforce Planning The Department operates daily emergency response operations with a total of 81.00 FTE line personnel, which includes 5.0 FTE positions eliminated as a result of budget constraints from the Coronavirus pandemic. This includes three battalions that staff six fire stations in the City and Stanford 24 hours each day. Over the last period, the Department has operated with 5.0 captain positions vacant and 12.0 employees off-line creating a total of 17.00 FTE positions that require backfill. The Department worked closely with Human Resources and the City to obtain required eliminations through attrition. As of December 2020, seven of the eight total Firefighter positions required to be eliminated were vacant as employees retired or separated from the City. This six month period also involved a Fire Captain promotional process, as many of the retirements were from the Fire Captain rank. Six Firefighters were promoted to fill the Fire Captain and Fire Training Captain positions. All other hiring activities are suspended at this time due to the fiscal outlook. Vacancies and Off-Line Employees FY21 JUL-DEC Classification Budgeted FTE Vacancies Off-Line Employees (Workers Comp/Light Duty) Personnel On Line Percent of Personnel On Line Battalion Chief 4.0 0.0 0.0 3.0 100% Fire Captain 21.0 5.0 2.0 14.0 67% Fire Apparatus Operator & Fire Fighters 56.0 0.0 10.0 45.0 82% TOTAL 781.0 5.0 12.0 62.00 78% Succession Planning FY20 JUL-DEC FY21 JUL-DEC Personnel Number of Shift Staff Currently Eligible to Retire 22 18 Number of Shift Staff Eligible to Retire in Five Years 16 15 Percent of all Shift Staff Eligible to Retire within Five Years 43% 40% Number of Acting Battalion Chief Hours 0 0 Number of Acting Captain Hours 2,278 7,466 Number of Acting Apparatus Operator Hours 8,162 9,616 Hours of Training Completed 23,917 9,112 Average Hours Per Line Personnel 310 147 PAFD VITAL SIGNS REPORT SURVEYS RECEIVED 7-1-2020 THROUGH 12-31-2020 FILTERS: SURVEY: 1 P.O. Box 100, Andover MA 01810 (844) 340-6060 Feedback-Innovations.com 1.0 EXECUTIVE SUMMARY PAFD received a total of 81 responses for this period. The highest rated section was Overall, with a total score of 96.6. The lowest rated section was Billing, with a total score of 86.87. •The Overall section had a 1.2% increase in Overall rating of experience Valoración general de la experiencia. •The Billing section had a 0.2% decrease in Ability of billing personnel to meet your needs Capacidad del personal de facturación para satisfacer sus necesidades . This question and section may represent specific areas for improvement. •Percentile ranking this period is lower 32.5%. Cumulative Score: 94.33 The benchmark is the mean average of all responses for all services in the Feedback Innovations database. VITAL SIGNS PATIENT SATISFACTION REPORT 1 VITAL SIGNS PATIENT SATISFACTION REPORT 2 2.0 IMPROVEMENT PRIORITY RANKING Rank Question 1 Professionalism of person on the phone Profesionalidad de la persona al teléfono 2 Ability of person on phone to meet your needs Capacidad de la persona al teléfono para satisfacer sus necesidades 3 Speed in which person on the phone dispatched help Velocidad en que la persona al teléfono envió la ayuda 4 Information given prior to ambulance arrival Información ofrecida antes de la llegada de la ambulancia 5 Helpfulness of billing personnel Amabilidad del personal de facturación 6 Ability of billing personnel to meet your needs Capacidad del personal de facturación para satisfacer sus necesidades 7 Responsiveness of billing personnel to billing issues Capacidad de respuesta a los problemas de facturación 8 Cleanliness of ambulance Limpieza de la ambulancia 9 Wait time to get an ambulance Tiempo de espera para conseguir una ambulancia 10 Degree to which service was worth the fees Grado en que el servicio es digno de los honorarios 11 Likelihood of recommending ambulance service Probabilidad de recomendar el servicio 12 Ambulance staff's concern for your privacy La preocupación del personal del ambulancia en cuanto a su privacidad 13 Degree ambulance staff took your condition seriously Grado en que el personal del ambulancia se tomó en serio su condición 14 Ambulance staff's efforts to inform you about treatment Los esfuerzos del personal del ambulancia para informarle sobre el procedimiento 15 Comfort of ambulance ride Confort durante el viaje en ambulancia 16 Your confidence in skill of ambulance staff Su confianza en la experiencia del personal del ambulancia 17 Degree to which the ambulance staff worked together to care for you Grado en que el personal del ambulancia trabajó en equipo para cuidar de usted 18 How well your pain was controlled ¿En qué grado se ha controlado su dolor? 19 Ambulance staff cared for you as a person Cuidados recibidos por personal del ambulancia 20 Your comfort when moved by ambulance staff Su comodidad cuando fue trasladado por el personal del ambulancia The Improvement Priority Ranking uses a combination of score and correlation to overall satisfaction to determine the most important areas for improvement. The closer to 1 the more important it is to your patients that this aspect of your service be improved upon. VITAL SIGNS PATIENT SATISFACTION REPORT 3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TABLE OF CONTENTS 1.0 EXECUTIVE SUMMARY 2.0 IMPROVEMENT PRIORITY RANKING TABLE OF CONTENTS 4.0 SECTIONS 4.1 Dispatch 4.2 Communication 4.3 Medical Care 4.4 Billing 4.5 Service Quality 4.6 Overall 1 3 4 5 5 6 7 8 9 10 3.0 DEMOGRAPHIC INFORMATION VITAL SIGNS PATIENT SATISFACTION REPORT 4 4.0 SECTIONS 4.1 Dispatch Percentile ranking this period is lower 35.0%. The Dispatch section showed a 0.75% decrease overall from Previous Period to Current Period, with a total score of 95.65. Drilling down by question for the Dispatch section: •There was a 1.2% decrease for Professionalism of person on the phone Profesionalidad de la persona al teléfono, with a score of 95.4. •There was a 0.6% decrease for Ability of person on phone to meet your needs Capacidad de la persona al teléfono para satisfacer sus necesidades , with a score of 96.2. •There was a 0.6% decrease for Speed in which person on the phone dispatched help Velocidad en que la persona al teléfono envió la ayuda, with a score of 96.4. •There was a 0.6% decrease for Information given prior to ambulance arrival Información ofrecida antes de la llegada de la ambulancia, with a score of 94.6. VITAL SIGNS PATIENT SATISFACTION REPORT 5 4.2 Communication Percentile ranking this period is lower 35.0%. The Communication section showed a 0.7% decrease overall from Previous Period to Current Period, with a total score of 96.3. Drilling down by question for the Communication section: •There was a 1.8% decrease for Ambulance staff's concern for your privacy La preocupación del personal del ambulancia en cuanto a su privacidad , with a score of 94.8. •There was a 0.2% decrease for Degree ambulance staff took your condition seriously Grado en que el personal del ambulancia se tomó en serio su condición , with a score of 97.8. •There was a 1.6% decrease for Ambulance staff's efforts to inform you about treatment Los esfuerzos del personal del ambulancia para informarle sobre el procedimiento, with a score of 94.6. •There was a 0.8% increase for Degree to which the ambulance staff worked together to care for you Grado en que el personal del ambulancia trabajó en equipo para cuidar de usted , with a score of 98.0. VITAL SIGNS PATIENT SATISFACTION REPORT 6 4.3 Medical Care Percentile ranking this period is upper 37.5%. The Medical Care section showed a 0.0% increase overall from Previous Period to Current Period, with a total score of 96.08. Drilling down by question for the Medical Care section: •There was a 0.2% decrease for Your confidence in skill of ambulance staff Su confianza en la experiencia del personal del ambulancia, with a score of 97.2. •There was a 0.6% increase for Ambulance staff cared for you as a person Cuidados recibidos por personal del ambulancia, with a score of 97.8. •There was a 1.2% decrease for How well your pain was controlled ¿En qué grado se ha controlado su dolor?, with a score of 94.0. •There was a 0.2% decrease for Your comfort when moved by ambulance staff Su comodidad cuando fue trasladado por el personal del ambulancia , with a score of 96.6. •There was a 1.0% increase for Comfort of ambulance ride Confort durante el viaje en ambulancia, with a score of 94.8. VITAL SIGNS PATIENT SATISFACTION REPORT 7 4.4 Billing Percentile ranking this period is lower 15.0%. The Billing section showed a 0.13% decrease overall from Previous Period to Current Period, with a total score of 86.87. Drilling down by question for the Billing section: •There was a 0.4% increase for Helpfulness of billing personnel Amabilidad del personal de facturación, with a score of 88.0. •There was a 0.2% decrease for Ability of billing personnel to meet your needs Capacidad del personal de facturación para satisfacer sus necesidades , with a score of 86.6. •There was a 0.6% decrease for Responsiveness of billing personnel to billing issues Capacidad de respuesta a los problemas de facturación, with a score of 86.0. VITAL SIGNS PATIENT SATISFACTION REPORT 8 4.5 Service Quality Percentile ranking this period is lower 27.5%. The Service Quality section showed a 0.1% increase overall from Previous Period to Current Period, with a total score of 94.5. Drilling down by question for the Service Quality section: •There was a 0.0% increase for Cleanliness of ambulance Limpieza de la ambulancia, with a score of 96.6. •There was a 0.4% increase for Wait time to get an ambulance Tiempo de espera para conseguir una ambulancia, with a score of 97.2. •There was a 0.8% decrease for Degree to which service was worth the fees Grado en que el servicio es digno de los honorarios , with a score of 90.0. •There was a 0.8% increase for Likelihood of recommending ambulance service Probabilidad de recomendar el servicio , with a score of 94.2. VITAL SIGNS PATIENT SATISFACTION REPORT 9 4.6 Overall Percentile ranking this period is lower 32.5%. The Overall section showed a 1.2% increase overall from Previous Period to Current Period, with a total score of 96.6. Drilling down by question for the Overall section: •There was a 1.2% increase for Overall rating of experience Valoración general de la experiencia, with a score of 96.6. VITAL SIGNS PATIENT SATISFACTION REPORT 10 From:Navi Thukral To:Blackshire, Geoffrey Cc:Henrikson, James Subject:Appreciation . Date:Thursday, August 6, 2020 1:52:22 PM CAUTION: This email originated from outside of the organization. Be cautiousof opening attachments and clicking on links. Good Afternoon Chief Geo.B & Fire Marshal James.H, I'm Naveen who's the owner of a small fire protection company . Last year I got a chance to work with a major developer . Fortunately I have got some good size projects in Palo Alto but i was very sceptical & apprehensive about the plan check procedure and local fire department inspection. I like to say thanks to city officials Mr John Parks & Karl Schinider both helped me a lot to execute my projects successfully . Whenever i needed any technical assistance weather it's NFPA 13 code and permit issue both these officials were very cordial and supportive . It's simply a joy to work with these guys. Regards, Navin Thukral Tisco Fire System,Inc. 916-541-5051 From:Fire To:Blackshire, Geoffrey Subject:FW: Thank You & Matthew Updates (720 Holly Oak Dr) Date:Thursday, July 30, 2020 12:15:02 PM From: Lily Hsu [mailto:Lily.Hsu@gilead.com] Sent: Thursday, July 30, 2020 12:05 PM To: Fire Cc: 'david.hsu@gmail.com' Subject: Thank You & Matthew Updates (720 Holly Oak Dr) CAUTION: This email originated from outside of the organization. Be cautiousof opening attachments and clicking on links. Dear PA Firefighters: This is Lily from 720 Holly Oak Drive. I called 911 on July 27th at 12:48pm because our son Matthew was having an episode of febrile seizure and lost his conscious. I wanted to provide an update that Matthew is back to normal and his COVID test result is “Negative”. I wanted to say THANK YOU to all the heroes that saved him on Monday. We really appreciate their selfless service and would like to make a donation to your department as a token of our appreciation. Can you please let me know how to proceed? Thanks again, The HSU Family From:Fire To:Blackshire, Geoffrey Subject:FW: Thank you! Date:Thursday, July 30, 2020 11:45:27 AM Hi Chief, Please share as you see fit. Thank you, Shannon From: Earl Caustin [mailto:earlcaustin@gmail.com] Sent: Thursday, July 30, 2020 11:18 AM To: Fire Subject: Thank you! CAUTION: This email originated from outside of the organization. Be cautiousof opening attachments and clicking on links. I live near Fire Station No.4. Periodically in the past I’ve stopped by with donuts and flowers just to say “Thank You!!” to the crew that daily puts themselves out and sometimes puts their lives in danger to make myself, my family, and my neighbors safe. In today’s world of Covid-19, I can’t drop things off. So please just pass on my HUGE“Thank You” to the Station No. 4 crew and to the whole Palo Alto Fire Department team that stands behind them and is there for all the residents of Palo Alto. THANK YOU !!!!!!! Earl Caustin