Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2020-08-03 City Council Agenda Packet
City Council 1 Monday, August 3, 2020 Special Meeting 5:00 PM Agenda posted according to PAMC Section 2.04.070. Supporting materials are available online on the Thursday 11 days preceding the meeting. ****BY VIRTUAL TELECONFERENCE ONLY*** https://zoom.us/join Meeting ID: 362 027 238 Phone:1(669)900-6833 Pursuant to the provisions of California Governor’s Executive Order N-29-20, issued on March 17, 2020, to prevent the spread of Covid-19, this meeting will be held by virtual teleconference only, with no physical location. The meeting will be broadcast on Cable TV Channel 26, live on YouTube at https://www.youtube.com/c/cityofpaloalto, and Midpen Media Center at https://midpenmedia.org. Members of the public who wish to participate by computer or phone can find the instructions at the end of this agenda. To ensure participation in a particular item, we suggest calling in or connecting online 15 minutes before the item you wish to speak on. TIME ESTIMATES Time estimates are provided as part of the Council's effort to manage its time at Council meetings. Listed times are estimates only and are subject to change at any time, including while the meeting is in progress. The Council reserves the right to use more or less time on any item, to change the order of items and/or to continue items to another meeting. Particular items may be heard before or after the time estimated on the agenda. This may occur in order to best manage the time at a meeting or to adapt to the participation of the public. HEARINGS REQUIRED BY LAW Applicants and/or appellants may have up to ten minutes at the outset of the public discussion to make their remarks and up to three minutes for concluding remarks after other members of the public have spoken. Call to Order Closed Session 5:00-5:30 PM 1.CONFERENCE WITH CITY ATTORNEY- EXISTING LITIGATION Santa Clara County Superior Court, Case No. 16CV300760 (One Case, as Defendant) –Miriam Green v. City of Palo Alto Authority: Government Code Section 54956.9(d)(1) Study Session 5:30-6:30 PM 2.City Council Discussion of Procedures for Virtual Council Meetings REVISED 2 August 3, 2020 Agenda Changes, Additions and Deletions Oral Communications 6:30-6:45 PM Members of the public may speak to any item NOT on the agenda. Council reserves the right to limit the duration of Oral Communications period to 30 minutes. Minutes Approval 6:45-6:50 PM 3.Approval of Action Minutes for the May 26, June 15, 16, 17, 22 and 23, 2020 City Council Meetings Consent Calendar 6:50-6:55 PM Items will be voted on in one motion unless removed from the calendar by three Council Members. 4.Approve and Authorize the City Manager or Designee to Execute Contract Number C20176772 With Burns & McDonnell in an Amount Not-to-Exceed $690,000 for the 60kV Breaker Replacement Design/Build Implementation, Capital Improvement Project EL-17002; and Authorization to Negotiate and Execute Related Change Orders in the Amount of $103,500, for a Total Not-to-Exceed Amount of $793,500 5.Approve and Authorize the City Manager or Designee to Execute the Following Utilities Communication, Graphic Design and Marketing Services Contracts in a Combined Not-to-Exceed Amount of $200,000 Annually and a Combined Not-to-Exceed Amount of $1,000,000 Over a Five-year Term: A) Eric Goldsberry Art Direction, C20176172A; B) Marketing for Change, C20176172B; and C) Underground Advertising, C20176172C; Finding of California Environmental Quality Act (CEQA) Exemption THIS ITEM REMOVED FROM THE AGENDA 6.QUASI-JUDICIAL. 3000 Alexis Drive [19PLN-00304]: Approval of the Record of Land Use Action (RLUA) Approving the Proposed Project, and Site and Design Review Application for the Palo Alto Hills Golf and Country Club to Renovate the 18-hole Golf Course. Environmental Assessment: Exempt From CEQA Pursuant to Guidelines Section 15304 (Minor Alterations to Land) Zoning District: OS (Open Space) 7.SECOND READING: Adoption of Amendments to the City of Palo Alto Tobacco Retailer Permit Ordinance (PAMC Chapter 4.64) to Further Restrict Electronic Cigarette Products and Flavored Tobacco Products (FIRST READING: June 16, 2020 PASSED: 4-3 DuBois, Fine, Kniss no) 8.SECOND READING: Adoption of an Ordinance to Reduce the Number of Human Relations Commission and Public Art Commission Members From Seven to Five (FIRST READING: June 22, 2020 PASSED: 5-2 Kou, Tanaka no) MEMO Public Comment Public Comment 3 August 3, 2020 9.Selection of Applicants to Interview for one Position on the Human Relations Commission and two Positions on the Public Art Commission City Manager Comments 6:55-7:05 PM Action Items Include: Reports of Committees/Commissions, Ordinances and Resolutions, Public Hearings, Reports of Officials, Unfinished Business and Council Matters. 7:05-8:30 PM 10.Discussion of the Parks and Recreation Commission's Pilot Program to Increase Access to Foothills Park for Non-residents and Provide Direction to Staff (Continued From June 23, 2020) 8:30-9:30 PM 11.Update and Discussion on Plan Bay Area 2050 Draft Blueprint and the Regional Housing Needs Allocation Process; and Direction to Staff to Prepare Comment Letters on These Regional Efforts 9:30-10:30 PM 12.Discussion and Direction Regarding Potential Placement of a CalTrain 1/8-cent Sales Tax Measure on the November 3, 2020 Ballot Council Member Questions, Comments and Announcements Members of the public may not speak to the item(s) Adjournment AMERICANS WITH DISABILITY ACT (ADA) Persons with disabilities who require auxiliary aids or services in using City facilities, services or programs or who would like information on the City’s compliance with the Americans with Disabilities Act (ADA) of 1990, may contact (650) 329-2550 (Voice) 24 hours in advance. MEMO MEMO Presentation Public Comment Presentation Public Comment Public Comment Presentation 4 August 3, 2020 Additional Information Standing Committee Meetings Sp. Council Appointed Officers Committee Meeting July 28, 2020 Finance Committee Meeting Cancellation August 4, 2020 Schedule of Meetings Schedule of Meetings Tentative Agenda Tentative Agenda Informational Report City of Palo Alto 2020 Water Gas and Wastewater Utility Standards Public Letters to Council Set 1 June 23-July 22, 2020 City Council Recess Summary Report 5 August 3, 2020 Public Comment Instructions Members of the Public may provide public comments to teleconference meetings via email, teleconference, or by phone. 1. Written public comments may be submitted by email to city.council@cityofpaloalto.org. 2. Spoken public comments using a computer will be accepted through the teleconference meeting. To address the Council, click on the link below to access a Zoom-based meeting. Please read the following instructions carefully. A. You may download the Zoom client or connect to the meeting in- browser. If using your browser, make sure you are using a current, up-to-date browser: Chrome 30+, Firefox 27+, Microsoft Edge 12+, Safari 7+. Certain functionality may be disabled in older browsers including Internet Explorer. B. You may be asked to enter an email address and name. We request that you identify yourself by name as this will be visible online and will be used to notify you that it is your turn to speak. C. When you wish to speak on an Agenda Item, click on “raise hand.” The Clerk will activate and unmute speakers in turn. Speakers will be notified shortly before they are called to speak. D. When called, please limit your remarks to the time limit allotted. E. A timer will be shown on the computer to help keep track of your comments. 3. Spoken public comments using a smart phone will be accepted through the teleconference meeting. To address the Council, download the Zoom application onto your phone from the Apple App Store or Google Play Store and enter the Meeting ID below. Please follow the instructions B-E above. 4. Spoken public comments using a phone use the telephone number listed below. When you wish to speak on an agenda item hit *9 on your phone so we know that you wish to speak. You will be asked to provide your first and last name before addressing the Council. You will be advised how long you have to speak. When called please limit your remarks to the agenda item and time limit allotted. https://zoom.us/join Meeting ID: 362 027 238 Phone:1(669)900-6833 City of Palo Alto (ID # 11499) City Council Staff Report Report Type: Study Session Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: Council Discussion on Virtual Meetings Title: City Council Discussion of Procedures for Virtual Council Meetings From: City Manager Lead Department: City Manager Recommendation Staff recommends that Council review its procedures for the conduct of virtual meetings. Background The Coronavirus pandemic has necessitated dramatic changes in the nature of public meetings across the nation. In California, on March 17, 2020 Governor Newsom signed Executive Order N-29-20 that suspends, on an emergency basis pursuant to Government Code § 8571, certain provisions of the Brown Act’s general requirements for public meetings. The suspension will remain in effect only as long as state or local public health officials have imposed or recommended social distancing measures. Similarly, the Palo Alto City Council’s Procedures and Protocols Handbook contains a number of provisions, such as “telephonic attendance,” that are not applicable to completely virtual meetings. The Palo Alto City Council has been holding completely virtual meetings since April 6, 2020 and continues today. At this time there is no indication of a date at which the council will return to in-person meetings. Following the July recess, this is an opportune time to review and affirm best practices for conducting virtual meetings. Discussion Mayor Fine and Councilmember Cormack have prepared the attached set of suggested practices for council discussion. Subject to council discussion, these practices can be informally implemented, or incorporated as a temporary addendum to the Council’s Procedures and Protocols Handbook. Environmental Review This is not a project as defined by the California Environmental Quality Act (CEQA). City of Palo Alto Page 2 Attachments A: Mayor Fine and Councilmember Cormack notes B: City Council Procedures and Protocols Handbook (Feb 1, 2020) C: California Governor’s Executive Order N-29-20 (Mar 17, 2020) Attachments: • Attachment A: Memo From Cormack and Fine • Attachment B: 3.17.20-N-29-20-Executive Order TO: HONORABLE COUNCIL MEMBERS FROM: COUNCIL MEMBER ALISON CORMACK AND MAYOR ADRIAN FINE DATE: AUGUST 3, 2020 SUBJECT: BEST PRACTICES FOR ONLINE PUBLIC MEETINGS Best Practices for Online Public Meetings As our nation and community grapple with concurrent major crises, public participation in government decision-making is of even greater importance. But it is also more challenging due to the remote or virtual nature of our meetings. Additionally, the issues we face have brought many new voices - and passion - to our City Council meetings. In order to effectively manage and execute the public’s business, these guidelines can help us all provide input, ask questions, and make better decisions in the community’s interest. The City of Palo Alto is committed to making it easy and accessible for members of the public to attend and participate in public meetings. The following is a list of best practices for councilmembers, members of the public, and city staff to participate in remote, online public meetings. Some of these are best practices while others are codified in the City Council Procedures and Protocols Handbook. Ultimately, it is up to each of us to behave professionally and with respect for others. For Councilmembers: • Councilmembers should endeavor to have their video on at all times so that the public, staff, and colleagues can see that they are listening. A minimum of four members must be on video to constitute a quorum. Brief turnoffs are understandable and permitted, but for example, having video off throughout public comments and then turning it back on when it is time for Councilmembers to speak is not appropriate for a public meeting. • The Chair will strive to give ten minute breaks every two hours to allow everyone to move around and eat or drink as desired. • The Chair will identify what “type” of round Council is on: questions, comments, or Motions. • Councilmembers should only speak when recognized by the Chair. • Councilmembers should limit themselves to 5 minutes per round of speaking, and will be alerted when they reach 5 minutes. • For each round, the Chair will note the order of the speakers as councilmembers raise their hands in Zoom. Motions and Amendments are considered new rounds, and the order of speaking is cleared, except for the maker and seconder of a Motion. Once a round is completed, the Chair will try to return to the original speaking order. • If only one or two councilmembers would like additional time, the Chair can move to the next order of business (next item, voting, etc). This prevents a minority of councilmembers from being the only speakers round after round. • When voting, the Chair will identify the sequence of voting, and will try to mix the order to not give anyone a privilege in terms of sequence. I.E., A→Z, then B→A, then C→B, and so on. • State law requires councilmembers to vocalize their vote, and councilmembers should not speak beyond a simple “yes” or “no”. Hand waves or thumbs-up do not count! For Members of the Public: • Members of the public are encouraged to attend and participate in all of Palo Alto’s public meetings, including Board and Commission meetings, standing council committees, and City Council meetings. • Members of the public are welcome to speak on any agendized item (an item with a number attached to it), where their comments should pertain to that item, or during Oral Communications, where they are welcome to address items not on the agenda but within Council’s purview. • Members of the public may not speak to items such as Call to Order, Agenda Changes, Additions and Deletions, City Manager Comments, Council Member Questions, Comments and Announcements, or Adjournment. • The City Council is not permitted to enter into debate or discussion in response to public comments, though the Chair may direct the City Manager to respond to a particular comment at a later date. (See Protocols and Procedures Section 1.4, D, 1). • Members of the public who wish to speak on an item should raise their hand in Zoom, at which point the City Clerk will record their name on a numbered list which is presented in the meeting. This is intended to capture everyone who wishes to speak and to communicate the order of speakers. • Members of the public may only speak on an item once, unless otherwise recognized by the Chair. (See Protocols and Procedures Section 1.4, B.) • At the beginning of the public comment period, the Chair will indicate how long public comment will last, how much time each speaker will have, and if public comment will be ended at a certain time. The Chair will announce when the Council will stop accepting public speakers, and the City Clerk will announce the final speaker on the list. • The default speaking time for all public comments is 3 minutes, but the Chair may reduce that to accommodate a large number of speakers. (See Protocols and Procedures Section 1.4, D, 1). • Five or more members of the public who are in attendance at the meeting may speak as a group by indicating to the City Clerk they would like to do so, and will be allotted a larger amount of time. All members of the group must be on the Zoom meeting. (See Protocols and Procedures Section 1.4, D, 3). • If they have nothing additional to add, members of the public are encouraged to signal their support for another speaker’s comments. • The Chair may limit Oral Communications to 30 minutes when necessary in order to allow time for the remaining items on the agenda. The Chair may also allow additional Oral Communications at the end of the agenda. (See Protocols and Procedures Section 1.4, D, 1). • Members of the public, Councilmembers, and City Staff should all act with respect and decorum and should not use the council chambers (virtual or in-person) for any purpose other than participation in or observation of City Council Meetings. (See Protocols and Procedures Section 1.4, D, 6). CITY OF PALO ALTO OFFICE OF THE CITY CLERK August 3, 2020 The Honorable City Council Attention: Finance Committee Palo Alto, California Approval of Action Minutes for the May 26, June 15, 16, 17, 22 and 23, 2020 City Council Meetings Staff is requesting Council review and approve the attached Action Minutes. ATTACHMENTS: • Attachment A: 05-26-2020 DRAFT Action Minutes (PDF) • Attachment B: 06-15-2020 DRAFT Action Minutes (PDF) • Attachment C: 06-16-2020 DRAFT Action Minutes (PDF) • Attachment D: 06-17-2020 DRAFT Action Minutes (PDF) • Attachment E: 06-22-2020 DRAFT Action Minutes (PDF) • Attachment F: 06-23-2020 DRAFT Action Minutes (PDF) Department Head: Beth Minor, City Clerk Page 2 CITY OF PALO ALTO CITY COUNCIL DRAFT ACTION MINUTES Page 1 of 6 Special Meeting May 26, 2020 The City Council of the City of Palo Alto met on this date via virtual teleconference at 1:03 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Action Items 1. City Manager's Fiscal Year 2021 Proposed Operating and Capital Budget and Municipal Fee Schedule Wrap-up, and Adoption of an Ordinance Amending Section 2.04.360 of the Palo Alto Municipal Code to Allow Council Members a Salary Waiver Option. Council took a break at 3:57 P.M. and returned at 4:12 P.M. MOTION: Council Member Kniss moved, seconded by Council Member Tanaka to keep the strategy to manage attrition in Police and Fire in short- term parking lot until the June 22, 2020 City Council Meeting. MOTION PASSED: 7-0 MOTION: Vice Mayor DuBois moved, seconded by Mayor Fine to reduce the Transportation Management Association (TMA) Fund to $453,000 and use the savings to assist city-wide COVID-19 business support efforts. AMENDMENT: Council Member Cormack moved, seconded by Council Member XX for $150,000 to be used to restore shuttle service and for the remainder ($147,000) to assist with COVID-19 business support efforts. AMENDMENT FAILED DUE TO THE LACK OF A SECOND MOTION PASSED: 7-0 Council took a break at 5:56 P.M. and returned at 6:30 P.M. DRAFT ACTION MINUTES Page 2 of 6 Sp. City Council Meeting Draft Action Minutes 5/26/2020 MOTION: Council Member Kniss moved, seconded by Council Member Filseth to fund the City Council minutes transcription ($35,000). MOTION PASSED: 5-2 Fine, Tanaka no MOTION: Council Member Kniss moved, seconded by Council Member Cormack to fund the cost of printing City Council materials ($35,000). MOTION PASSED: 6-1 Tanaka no MOTION: Council Member Kou moved, seconded by Council Member Kniss to restore funding for Youth Community Service (YCS) Youth Connectedness Initiative ($25,000). SUBSTITUTE MOTION: Council Member Cormack moved, seconded by Council Member XX to revisit this later in the year, funding for Youth Community Service (YCS) Youth Connectedness Initiative ($25,000). SUBSTITUTE MOTION WITHDRAWN BY THE MAKER INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, “…for a total of $50,000.” MOTION AS AMENDED RESTATED: Council Member Kou moved, seconded by Council Member Kniss to restore funding for YCS Youth Connectedness Initiative ($25,000), for a total of $50,000. MOTION AS AMENDED PASSED: 7-0 MOTION: Vice Mayor DuBois moved, seconded by Council Member Kniss to leave funding for KZSU ($20,000) in the short-term parking lot until June 22, 2020. MOTION PASSED: 7-0 MOTION: Council Member Cormack moved, seconded by Council Member Filseth to designate the remaining $744,000 of the unallocated funds into a “COVID-19 Uncertainty Reserve Fund” to be revisited in September 2020 and again in December 2020, to be used in the following areas: Community Services, ongoing COVID-19 Response, Public Safety Operations, and Shuttle Systems. DRAFT ACTION MINUTES Page 3 of 6 Sp. City Council Meeting Draft Action Minutes 5/26/2020 INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, “…or others as proposed by Staff.” MOTION AS AMENDED RESTATED: Council Member Cormack moved, seconded by Council Member Filseth to designate the remaining $744,000 of the unallocated funds into a “COVID-19 Uncertainty Reserve” Fund to be revisited in September 2020 and again in December 2020, to be used in the following areas: Community Services, ongoing COVID-19 response, Public Safety operations, and Shuttle Systems, or others as proposed by Staff. MOTION AS AMENDED PASSED: 6-1 Tanaka no MOTION: Mayor Fine moved, seconded by Council Member Cormack to allow the Transportation Management Association (TMA) to expand to California Avenue in the upcoming year. MOTION PASSED: 7-0 Council took a break at 8:18 P.M. and returned at 8:30 P.M. MOTION: Vice Mayor DuBois moved, seconded by Council Member Kou to direct Staff to return with a temporary suspension of 1 percent for Public Art, for two years, and reevaluate at the mid-year budget check-in. MOTION PASSED: 4-3 Cormack, Fine, Kniss no MOTION: Council Member Tanaka moved, seconded by Council Member XX to fund Palo Alto Schools for $2.5 million. MOTION WITHDRAWN BY THE MAKER MOTION: Council Member Tanaka moved, seconded by Council Member XX to direct Staff to estimate the amount of market rent that would be collected for all the property owned by the City. MOTION FAILED DUE TO THE LACK OF A SECOND MOTION: Council Member Tanaka moved, seconded by Council Member XX to propose that computer equipment cycles are returned to 5-year cycles. DRAFT ACTION MINUTES Page 4 of 6 Sp. City Council Meeting Draft Action Minutes 5/26/2020 MOTION FAILED DUE TO THE LACK OF A SECOND MOTION: Council Member Tanaka moved, seconded by Council Member XX to keep the funding for 1.0 Police Lieutenant in the Police Department versus moving the position to the City Manager’s Office. MOTION FAILED DUE TO THE LACK OF A SECOND MOTION: Council Member Tanaka moved, seconded by Council Member XX to reduce the number of recruiters in the Human Resources Department from 5 to 2. MOTION FAILED DUE TO THE LACK OF A SECOND MOTION: Council Member Tanaka moved, seconded by Council Member Kniss to direct Staff to explore changing delivery of services from a dominant fire-oriented model to a dominant medical-oriented model. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to change the Motion to read, “…to explore changing emergency services delivery…” MOTION AS AMENDED RESTATED: Council Member Tanaka moved, seconded by Council Member Kniss to direct Staff to explore changing emergency services delivery from a dominant fire-oriented model to a dominant medical-oriented model. MOTION AS AMENDED PASSED: 7-0 MOTION: Vice Mayor DuBois moved, seconded by Council Member Filseth to direct the Finance Committee to evaluate the ability to fund the Roth Building renovations through the General Fund (not to exceed $1 million) or impact fees, with the preference for impact fees. MOTION FAILED: 2-5 Cormack, Filseth, Fine, Kniss, Tanaka no MOTION: Vice Mayor DuBois moved, seconded by Council Member Kou to direct Staff to return with a report or item on the Junior Museum and Zoo and what it would look like to eliminate the General Fund subsidy through a fully cost recoverable program. DRAFT ACTION MINUTES Page 5 of 6 Sp. City Council Meeting Draft Action Minutes 5/26/2020 INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, “…six months after it reopens…” MOTION AS AMENDED RESTATED: Vice Mayor DuBois moved, seconded by Council Member Kou to direct Staff to return with a report or item on the Junior Museum and Zoo, six months after it reopens, and what it would look like to eliminate the General Fund subsidy through a fully cost recoverable program. MOTION AS AMENDED PASSED: 5-2 Kniss, Tanaka no MOTION: Council Member Kou moved, seconded by Council Member XX to direct Staff to return with a discussion of price changes and increases for employee permits in all garages and lots in the California Avenue district to be consistent city wide. MOTION WITHDRAWN BY THE MAKER MOTION: Council Member Cormack moved, seconded by Mayor Fine to adopt the Ordinance Amending Section 2.04.360 of the Palo Alto Municipal Code to Allow Council Members to provide a Salary Waiver Option. MOTION PASSED: 7-0 MOTION: Mayor Fine moved, seconded by Vice Mayor DuBois to: A. Direct Staff in regard to the City Manager’s Fiscal Year 2021 Proposed Operating and Capital Budgets and Fiscal Years 2021 Municipal Fee Schedule including the following amendments detailed below, as amended via City Council motions, for Staff to return on June 22, 2020 with the final Fiscal Year 2021 budgets for City Council adoption: i. Formal adoption of the City Manager’s Fiscal Year 2021 Proposed Operating and Capital Budgets as amended by the actions outlined in Attachment A, Exhibit 1 and Exhibit 2 of CMR 11376; ii. Formal adoption of the Fiscal Year 2021 Municipal Fee Schedule; DRAFT ACTION MINUTES Page 6 of 6 Sp. City Council Meeting Draft Action Minutes 5/26/2020 iii. Formal adoption of the Table of Organization (Pages 339 – 356 in the Fiscal Year 2021 Proposed Operating Budget) as amended by the above actions; and iv. Formal approval of the Fiscal Year 2021 – Fiscal Year 2025 Capital Improvement Plan as revised through Attachment A, Exhibit 2 of CMR 11376. MOTION PASSED: 6-1 Tanaka no ADJOURNMENT: The meeting was adjourned at 10:10 P.M. honoring the men and women who gave their lives while serving in the U.S. military. CITY OF PALO ALTO CITY COUNCIL FINAL ACTION MINUTES Page 1 of 8 Special Meeting June 15, 2020 The City Council of the City of Palo Alto met on this date via Virtual Teleconference at 5:02 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Closed Session A. CONFERENCE WITH LABOR NEGOTIATORS City Designated Representatives: City Manager and his Designees Pursuant to Merit System Rules and Regulations (Ed Shikada, Rumi Portillo, Molly Stump, Monique LeConge Ziesenhenne, Nick Raisch, Kiely Nose, Gina Roccanova). Employee Organizations: Utilities Management and Professional Association of Palo Alto (UMPAPA); Service Employees International Union, (SEIU) Local 521; Service Employees International Union, (SEIU) Local 521, Hourly Unit; Palo Alto Police Officers Association (PAPOA); Palo Alto Fire Chiefs’ Association (FCA) and Employee Organization: International Association of Fire Fighters (IAFF), Local 1319; Palo Alto Police Manager’s Association (PAPMA). Authority: Government Code Section 54957.6(a). MOTION: Council Member Kniss moved, seconded by Council Member Cormack to go into Closed Session. MOTION PASSED: 7-0 Council went into Closed Session at 5:05 P.M. Council returned from Closed Session at 6:33 P.M. Mayor Fine announced no reportable action. Minutes Approval 1. Approval of Action Minutes for the May 11, 12, 13, and June 1, 2020 Council Meetings. DRAFT ACTION MINUTES Page 2 of 8 City Council Meeting Final Action Minutes: 06/15/2020 MOTION: Mayor Fine moved, seconded by Council Member Cormack to approve the Action Minutes for the May 11, 12, 13, and June 1, 2020 Council Meetings. MOTION PASSED: 7-0 Consent Calendar Council Member Kou registered a no vote on Agenda Item Number 2. Council Member Tanaka registered a no vote on Agenda Item Numbers 3 and 4. MOTION: Vice Mayor DuBois moved, seconded by Council Member Kniss to approve Agenda Item Numbers 2-5. 2. Approval of Contract Number C20176877 With Schaaf & Wheeler Consulting Civil Engineers in the Amount of $789,918 for Design Services for the: 1) Corporation Way System Upgrades and Pump Station, 2) West Bayshore Road Pump Station, and 3) Trunk Line Improvement Projects; Capital Improvement Program Projects (SD- 21000, SD-20000, and SD-23000). 3. Approval and Authorization for the City Manager or Designee to Execute the Following Three Utilities Public Benefits Program Contract Amendments: 1) Amendment Number 2 to Ecology Action of Santa Cruz (C15155144A), With no Increase in Compensation and Extending the Term for one Additional Year; 2) Amendment Number 2 to Enovity, Inc. (C15155144B), With no Increase in Compensation and Extending the Term for one Additional Year; and 3) Amendment Number 2 to BASE Energy, Inc. (C15155144C), With no Increase in Compensation and Extending the Term for one Additional Year. 4. Approval of Amendment Number 2 to Contract Number C17165394 With Genuine Parts Company, dba Napa Auto Parts, to Increase the Contract by $781,013 to an Amount Not-to-Exceed $3,777,087 and Extend the Term Through July 21, 2021. 5. Approval of Amendment Number 3 to Contract Number C18172676 With Dixon Resources to Extend the Term to June 2021 With no Additional Costs for the Downtown Parking Study. MOTION PASSED FOR AGENDA ITEM NUMBER 2: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBERS 3-4: 6-1 Tanaka no DRAFT ACTION MINUTES Page 3 of 8 City Council Meeting Final Action Minutes: 06/15/2020 MOTION PASSED FOR AGENDA ITEM NUMBER 5: 7-0 MOTION: Council Member Kou moved, seconded by Vice Mayor DuBois to move Agenda Item Number 10 to follow City Manager’s Comments. MOTION FAILED: 2-5 Cormack, Filseth, Fine, Kniss, Tanaka no Action Items 6. PUBLIC HEARING: Resolution 9892 Entitled, “Resolution of the Council of the City of Palo Alto Confirming the Weed Abatement Report and Ordering the Cost of Abatement to be a Special Assessment on the Respective Properties Described Therein.” Public Hearing opened at 7:29 P.M. Public Hearing closed at 7:32 P.M. MOTION: Vice Mayor DuBois moved, seconded by Council Member Kou to adopt the Resolution confirming the report and ordering abatement costs to be a special assessment on the properties specified in the report. MOTION PASSED: 7-0 7. Resolution 9893 Entitled, “Resolution of the Council of the City of Palo Alto Recommendation on the Proposed Fiscal Year (FY) 2020-2021 Community Development Block Grant (CDBG) Funding Allocation; Recommendation That the City Manager or Designee be Authorized to Execute Necessary Documents for the Fiscal Year 2020-2021 CDGB Application; and to Submit the 2020-2021 Action Plan and the 2020- 2025 Consolidated Plan to the Department of Housing and Urban Development (HUD) by the Extended Deadline of August 16, 2020.” MOTION: Vice Mayor DuBois moved, seconded by Council Member Cormack to: A. Adopt the funding Resolution allocating Community Development Block Grant (CDBG) funding as recommended in the draft 2020-2021 Action Plan; B. Authorize the City Manager to execute the Fiscal Year 2020-2021 CDBG application and Fiscal Year 2020-2021 Action Plan for CDBG funds and any other necessary documents concerning the application, and to otherwise bind the City with respect to the applications and commitment of funds; DRAFT ACTION MINUTES Page 4 of 8 City Council Meeting Final Action Minutes: 06/15/2020 C. Authorize Staff to submit the 2020-2021 Action Plan to the Department of Housing and Urban Development (HUD) by the extended deadline of August 16, 2020; and D. Authorize Staff to submit the 2020-2025 Consolidated Plan to HUD by the extended deadline of August 16, 2020. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, “Direct Staff to ask the Downtown Streets Team for a report on the harassment allegations by the end of August.” (New Part E) MOTION AS AMENDED RESTATED: Vice Mayor DuBois moved, seconded by Council Member Cormack to: A. Adopt the funding Resolution allocating Community Development Block Grant (CDBG) funding as recommended in the draft 2020-2021 Action Plan; B. Authorize the City Manager to execute the Fiscal Year 2020-2021 CDBG application and Fiscal Year 2020-2021 Action Plan for CDBG funds and any other necessary documents concerning the application, and to otherwise bind the City with respect to the applications and commitment of funds; C. Authorize Staff to submit the 2020-2021 Action Plan to the Department of Housing and Urban Development (HUD) by the extended deadline of August 16, 2020; and D. Authorize Staff to submit the 2020-2025 Consolidated Plan to HUD by the extended deadline of August 16, 2020; and E. Direct Staff to ask the Downtown Streets Team for a report on the harassment allegations by the end of August. MOTION AS AMENDED PASSED: 7-0 8. Resolution 9894 Entitled, “Resolution of the Council of the City of Palo Alto Updating the City’s Transportation Analysis Methodology Under California Environmental Quality Act (CEQA) to Comply With California Senate Bill 743; and Adoption of a Local Transportation Impact Analysis Policy to Evaluate Level of Service (LOS) and Other Local Roadway Impacts.” DRAFT ACTION MINUTES Page 5 of 8 City Council Meeting Final Action Minutes: 06/15/2020 MOTION: Council Member Filseth moved, seconded by Council Member Kniss to: A. Adopt a Resolution designating Vehicle Miles Traveled (VMT) as the metric for conducting transportation analyses pursuant to the California Environmental Quality Act (CEQA), establishing CEQA thresholds of significance related to VMT, and identifying screening criteria to limit review for projects presumed to have a less than significant VMT impact based on substantial evidence; and B. Adopt a Local Transportation Impact Analysis Policy establishing standards for conducting local-level transportation analyses, including Level of Service (LOS) consistent with Comprehensive Plan Program T2.3.1, and addressing identified deficiencies. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, “Direct Staff to return within 6-9 months with further review of LOS Standards.” (New Part C) INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, Part B, “to rephrase the Level of Service Standard, “The City of Palo Alto’s Level of Service (LOS) standard is D, which is more conservative than the CMP LOS standard of E. If the LTA shows that a development project is anticipated to cause a transportation facility (intersection or roadway) to degrade below LOS D to LOS E or F, then the project will be deemed to have significant local impact.” (New Part B.a) MOTION AS AMENDED RESTATED: Council Member Filseth moved, seconded by Council Member Kniss to: A. Adopt a Resolution designating Vehicle Miles Traveled (VMT) as the metric for conducting transportation analyses pursuant to the California Environmental Quality Act (CEQA), establishing CEQA thresholds of significance related to VMT, and identifying screening criteria to limit review for projects presumed to have a less than significant VMT impact based on substantial evidence; B. Adopt a Local Transportation Impact Analysis Policy establishing standards for conducting local-level transportation analyses, including Level of Service (LOS) consistent with Comprehensive Plan Program T2.3.1, and addressing identified deficiencies; i. Rephrase the Level of Service Standard, “The City of Palo Alto’s Level of Service (LOS) standard is D, which is more conservative DRAFT ACTION MINUTES Page 6 of 8 City Council Meeting Final Action Minutes: 06/15/2020 than the CMP LOS standard of E. If the LTA shows that a development project is anticipated to cause a transportation facility (intersection or roadway) to degrade below LOS D to LOS E or F, then the project will be deemed to have significant local impact.”; and C. Direct Staff to return within 6-9 months with further review of LOS Standards. MOTION AS AMENDED PASSED: 6-1 Kou no Council took a break at 9:06 P.M. and returned at 9:12 P.M. 9. Approval of two Lease Agreements Between Palo Alto Unified School District and the City of Palo Alto for: 1) Cubberley for 54 months, Not- to-Exceed Amount of $2,733,280 per Year, and 2) Extended Day Care Sites for 24 months, Not-to-Exceed Amount of $707,676 per Year. MOTION: Council Member Kniss moved, seconded by Council Member Kou to authorize the City Manager to execute the Lease Agreements between Palo Alto Unified School District (PAUSD) and the City of Palo Alto (City) for Cubberley for 54 months and Extended Day Care premises for 24 months, Not-to-Exceed amount of $707,676 per year. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to change the Motion to state, “…for Cubberley for 30 months…” MOTION AS AMENDED RESTATED: Council Member Kniss moved, seconded by Council Member Kou to authorize the City Manager to execute the Lease Agreements between Palo Alto Unified School District (PAUSD) and the City of Palo Alto (City) for Cubberley for 30 months, Not-to-Exceed amount of $2,733,280 per Year and Extended Day Care premises for 24 months, Not- to-Exceed amount of $707,676 per year. SUBSTITUTE MOTION: Council Member Tanaka moved, seconded by Council Member XX to direct Staff to have a more collaborative negotiation with the Palo Alto Unified School District (PAUSD). SUBSTITUTE MOTION FAILED DUE TO THE LACK OF A SECOND MOTION AS AMENDED PASSED: 6-1 Tanaka no 10. Review and Provide Initial Input on Options for a Framework and Workplan to Address Systemic Racism. DRAFT ACTION MINUTES Page 7 of 8 City Council Meeting Final Action Minutes: 06/15/2020 Council took a break at 11:24 P.M. and returned at 11:32 P.M. MOTION: Mayor Fine moved, seconded by Council Member Kniss to provide direction to Staff on a proposed initial framework and workplan to address police use of force and citywide issues related to race and equity to include the following: A. Direct the Human Relations Commission to lead the 8 Can’t Wait Initiative and to produce a report on the black community's history in Palo Alto; B. Expand community engagement to include private and public forums; C. Start Council Ad-Hoc Committees with monthly reports on: police hiring, data analysis, practices and policies, transparency, and accountability; D. Start a community-effort to paint “Black Lives Matter” or a similar message near City Hall; E. Direct the Public Art Commission to explore public art honoring diversity; and F. Direct Staff to evaluate which current police functions may be served by other public safety models. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, Part A, “and brown”. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, Part A, “within 90 days” and to the Motion, Part B, “within 30 days”. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to change the Motion, Part A from 90 days to 60 days. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to combine Motion, Part D and Part E. MOTION AS AMENDED RESTATED: Mayor Fine moved, seconded by Council Member Kniss to provide direction to Staff on a proposed initial framework and workplan to address police use of force and citywide issues related to race and equity to include the following: DRAFT ACTION MINUTES Page 8 of 8 City Council Meeting Final Action Minutes: 06/15/2020 A. Direct the Human Relations Commission to lead the “8 Can’t Wait” campaign and to produce a report on the black and brown history and current community in Palo Alto, within 60 days; B. Expand community engagement to include private and public forums, within 30 days; C. Start Council Ad-Hoc Committees with monthly reports on: police hiring, data analysis, practices and policies, transparency, and accountability; D. Direct the Public Art Commission to explore public art honoring diversity, and work with our community to paint “Black Lives Matter” or a similar message near City Hall, as soon as possible; and E. Direct Staff to evaluate which current police functions may be served by other public safety models. MOTION AS AMENDED PASSED: 7-0 Adjournment: The meeting was adjourned at 1:11 A.M. CITY OF PALO ALTO CITY COUNCIL FINAL ACTION MINUTES Page 1 of 3 Special Meeting June 16, 2020 The City Council of the City of Palo Alto met on this date via Virtual Teleconference at 5:03 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Action Items A. Adoption of Amendments to the City of Palo Alto Tobacco Retailer Permit Ordinance (Palo Alto Municipal Code Chapter 4.64) to Further Restrict Electronic Cigarette Products and Flavored Tobacco Products (CONTINUED FROM JUNE 8, 2020). MOTION: Council Member Kniss moved, seconded by Vice Mayor DuBois to Direct Staff to create an Ordinance with the following: A. A complete ban on vaping; B. To exempt adult-only stores to sell flavored tobacco products including cigar pipe, chewing, and paper cigarettes; and C. To exempt the onsite use of flavored tobacco products for currently permitted businesses. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to change Motion, Part A to read, “…complete ban on the sale of vaping products”. MOTION AS AMENDED RESTATED: Council Member Kniss moved, seconded by Vice Mayor DuBois to direct Staff to create an Ordinance with the following: A. A complete ban on the sale of vaping products; B. To exempt adult-only stores to sell flavored tobacco products including cigar, pipes, chewing, and paper cigarettes; and C. To exempt the onsite use of flavored tobacco products for currently permitted businesses. DRAFT ACTION MINUTES Page 2 of 3 City Council Meeting Final Action Minutes: 6/16/2020 SUBSTITUTE MOTION: Council Member Tanaka moved, seconded by Council Member Cormack to adopt amendments to the City of Palo Alto Tobacco Retailer Permit Ordinance (Palo Alto Municipal Code Chapter 4.64) to further restrict electronic cigarette products and flavored tobacco products. SUBSTITUTE MOTION PASSED: 4-3 DuBois, Fine, Kniss no Council took a break at 6:35 P.M. and returned at 6:43 P.M. 1. Direct Staff to Continue With the 2020 Sustainability and Climate Action Plan (S/CAP) Update and Evaluate the 2020 S/CAP Potential Goals and Key Actions (CONTINUED FROM JUNE 8, 2020). MOTION: Vice Mayor DuBois moved, seconded by Mayor Fine to direct Staff to continue with its work on the 2020 Sustainability and Climate Action Plan (S/CAP) Update and the evaluation of 2020 S/CAP Potential Major Goals and Key Actions related to greenhouse gas emissions reduction and direct Staff to look at a key indicator for biodiversity. MOTION PASSED: 7-0 Council took a break at 8:33 P.M. and returned at 8:46 P.M. 2. Review of the Third Quarter Financial Report and Approval of Various Fiscal Year (FY) 2020 Budget Adjustments to Address Projected COVID-19 Impacts. MOTION: Vice Mayor DuBois moved, seconded by Council Member Cormack to amend the Fiscal Year 2020 Budget Appropriation for various funds and various capital projects. MOTION PASSED: 6-1 Tanaka no 3. Discussion and Direction to Staff Regarding the: 1) Establishment of a Pension Funding Policy, 2) Approval of Contract Number C15159278 With Bartel Associates for a Six-year Term for Actuary Services in the Amount Not-to-Exceed of $132,325, and 3) and Authorization to the City Manager to Execute a Contract Amendment Number 1 to Contract Number C15159278 to Increase Funding by $97,675 for a Revised Total Not-to-Exceed $230,000 for Additional Actuarial Consultant Work Related to Long-term Obligations for Pension and Retiree Health Liabilities (CONTINUED FROM JUNE 8, 2020). DRAFT ACTION MINUTES Page 3 of 3 City Council Meeting Final Action Minutes: 6/16/2020 MOTION: Vice Mayor DuBois moved, seconded by Council Member Cormack to: A. Approve the example pension funding policy as outlined in Attachment C of Staff Report Number 11407; B. Approve and authorize the City Manager or his designee to execute Contract Number C15159278 with Bartel Associates, dated September 1, 2015, for an amount not to exceed $132,325 for OPEB and pension actuary and analysis services; and C. Approve and authorize the City Manager or his designee to execute Amendment No. 1 to Contract Number C15159278 with Bartel Associates to increase the funding by $97,675 for a revised total amount Not-To-Exceed $230,000 for additional actuarial consultant work related to long-term obligations for pension and retiree health liabilities. MOTION SPLIT FOR THE PURPOSE OF VOTING MOTION PART A PASSED: 7-0 MOTION PART B AND C PASSED: 6-1 Tanaka no Adjournment: The meeting was adjourned at 11:12 P.M. CITY OF PALO ALTO CITY COUNCIL DRAFT ACTION MINUTES Page 1 of 1 Special Meeting June 17, 2020 The City Council of the City of Palo Alto met on this date via Virtual Teleconference at 5:34 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Closed Session 1. CONFERENCE WITH REAL PROPERTY NEGOTIATORS Authority: Government Code Section 54956.8 Property: Cubberley Conveyance Property and Leased Site, 4000 Middlefield Road, Palo Alto, CA Assessor’s Parcel Nos. 147-08-052 and 053 Agency Negotiators: Ed Shikada, Kristen O’Kane, Molly Stump, Terence Howzell, Kiely Nose, David Ramberg, and Sunny Tong Negotiating Parties: City of Palo Alto and Palo Alto Unified School District. Under Negotiation: Lease Price and Terms of Payment. MOTION: Council Member Kniss moved, seconded by Council Member Cormack to go into Closed Session. MOTION PASSED: 7-0 Council went into Closed Session at 5:52 P.M. Council returned from Closed Session at 6:59 P.M. Mayor Fine announced based on feedback from school officials, and in continued partnership with the district, we unanimously endorse returning to the City Council next week to place the 54-month lease agreement with PAUSD for approval on the consent calendar. The City Council is legally not able to approve this lease agreement in a closed session discussion. The City Council appreciates the districts cooperation and flexibility. Note that the childcare lease was approved on Monday 6/15. Adjournment: The meeting was adjourned at 7:00 P.M. CITY OF PALO ALTO CITY COUNCIL FINAL ACTION MINUTES Page 1 of 10 Special Meeting June 22, 2020 The City Council of the City of Palo Alto met on this date via Virtual Teleconference at 5:01 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Closed Session 1. CONFERENCE WITH LABOR NEGOTIATORS City Designated Representatives: City Manager and his Designees Pursuant to Merit System Rules and Regulations (Ed Shikada, Rumi Portillo, Molly Stump, Monique LeConge Ziesenhenne, Nick Raisch, Kiely Nose, Gina Roccanova) Employee Organizations: Utilities Management and Professional Association of Palo Alto (UMPAPA); Service Employees International Union, (SEIU) Local 521; Service Employees International Union, (SEIU) Local 521, Hourly Unit; Palo Alto Police Officers Association (PAPOA); Palo Alto Fire Chiefs’ Association (FCA) and Employee Organization: International Association of Fire Fighters (IAFF), Local 1319; Palo Alto Police Manager’s Association (PAPMA) Authority: Government Code Section 54957.6(a). MOTION: Mayor Fine moved, seconded by Council Member Cormack to go into Closed Session. MOTION PASSED: 7-0 Council went into Closed Session at 5:05 P.M. Council returned from Closed Session at 5:52 P.M. Mayor Fine announced no reportable action. Study Session 2. 3300 El Camino Real (20PLN-00101): Request for Pre-screening of a Proposal to Rezone the Subject Property From Research Park (RP) to Planned Home Zoning (PHZ) and to Redevelop the Site With a Mixed- use Development That Includes Approximately 52,500 Square Feet (sf) DRAFT ACTION MINUTES Page 2 of 10 Final Action Minutes: 06/22/2020 of Office; 4,400 sf of Ground Floor Retail, and 187 Residential Units. Environmental Assessment: Not a Project; any Subsequent Formal Application Would be Subject to the California Environmental Quality Act (CEQA). Zoning District: RP. NO ACTION TAKEN Agenda Changes, Additions and Deletions MOTION: Vice Mayor DuBois moved, seconded by Council Member Kou to do a check-in at 10:30 P.M., and move Agenda Item Number 9 on June 23, 2020 Action Agenda to the June 23, 2020 Consent Calendar. MOTION PASSED: 4-3 Cormack, Kniss, Tanaka no MOTION: Council Member Kou moved, seconded by Vice Mayor DuBois to defer Agenda Item Numbers 6 and 8 on the June 23, 2020 Agenda to a date after the Council summer recess. MOTION PASSED: 5-2 Cormack, Fine no Minutes Approval 3. Approval of Action Minutes for the June 8, 2020 City Council Meeting. MOTION: Council Member Cormack moved, seconded by Council Member Kniss to approve the Action Minutes for the June 8, 2020 City Council Meeting. MOTION PASSED: 7-0 Consent Calendar MOTION: Council Member Kou moved, seconded by Council Member XXX, third by Council Member XXX to pull Agenda Item Numbers 20, 25, and 27. MOTION FAILED DUE TO THE LACK OF A SECOND AND THIRD MOTION: Council Member Tanaka moved, seconded by Council Member XXX, third by Council Member XXX to pull Agenda Item Number 21. MOTION FAILED DUE TO THE LACK OF A SECOND AND THIRD Council Member Kou registered no votes on Agenda Item Numbers 9, 13, 20, 25, 27, and 29. Council Member Tanaka registered no votes on Agenda Item Numbers 11, 24, 29, and 30A. DRAFT ACTION MINUTES Page 3 of 10 Final Action Minutes: 06/22/2020 Vice Mayor DuBois registered a no vote on Agenda Item Number 12. MOTION: Mayor Fine moved, seconded by Council Member Kniss to approve Agenda Item Numbers 4-30A. 1. Approval of a Contract Extension With AT&T, CALNET3 State Contract Number C15157655, Extending the Term Through December 31, 2021, for Telecommunications in an Amount Not-to-Exceed $300,000 Annually. 2. Approval of Contract Number C20175305A With AECOM in the Amount of $302,073 for Consultant Services to Develop a Sea Level Rise Vulnerability Assessment and Adaptation Plan. 3. Resolution 9895 Entitled, “Resolution of the Council of the City of Palo Alto and Approval of a Joint Powers Authority Agreement and Memorandum of Understanding to Join the California State Association of Counties Excess Insurance Authority (CSAC-EIA) for Dental/Vision Benefit Plan Claims Administration;” and Approval to pay up to $130,000 Annually to PBIA for Claims Administration Services and to Transfer Funds to PBIA Not-to-Exceed $710,000 for the 2020 Plan Year to pay Benefit Claims. 4. Adoption of the Fiscal Year 2021 Investment Policy. 5. Resolution 9896 Entitled, “Resolution of the Council of the City of Palo Alto Approving the Amended and Restated Market Purchase Program Agreement With the Northern California Power Agency (NCPA), Authorizing the City Manager or Designee to Authorize NCPA to Purchase and Sell Electricity and Related Products Under the Agreement, and Approving Revisions to the City’s Energy Risk Management Policy.” 6. Resolution 9897 Entitled, “Resolution of the Council of the City of Palo Alto to Approve Amendment Number 2 to the Agreement With the State of California for Maintenance of State Highways in the City of Palo Alto for Capital Improvement Program Project Charleston/Arastradero Corridor Project, PE-13011, and Authorization of the City Manager or Designee to Execute the Amendment.” 7. Approval of Eight On-call Consulting Contracts Totaling $1.5 Million Over a Four-year Term to Provide Expertise for Long Range Planning Projects, Application Processing, and Environmental Review in the Department of Planning & Development Services, With all Work Subject to Assigned Task Order and Availability of Funds. DRAFT ACTION MINUTES Page 4 of 10 Final Action Minutes: 06/22/2020 8. Approval of Three Five-year Professional Service Agreements for Electric Engineering Consulting Services on an As-needed Basis With: 1) AECOM Technical Services, Inc, 2) NV5, Inc, and 3) Soudi Consultants, Inc, for an Annual Collective Total Not-to-Exceed Amount of $1,000,000 per Year, and a Five-year Collective Total Not-to-Exceed Amount of $5,000,000, With all Work Subject to Assigned Task Orders and Availability of Funds. 9. Approval and Authorization for the City Manager to Execute Electric Enterprise Fund Contract Number C20177717 With Wire Wrangler, LLC, dba TW Power Line Construction, in an Amount of $1,906,408 for the Caltrain Facility Relocation Project (EL-17007) and Wood Pole Replacement Project (EL-19004); and Authorization to Negotiate and Execute Related Change Orders in the Amount of $190,641 for a Total Not-to-Exceed Amount of $2,097,049. 10. Approval of six Contracts for On-call Inspection and Plan Review Services in a Combined Amount Not-to-Exceed $6,000,000 Over a Four- year and Six-month Term Ending December 31, 2024 With: 1) 4Leaf, Inc, 2) TRB+Associates, 3) SAFEbuilt, 4) Shums Coda Associates, 5) Bureau Veritas, and 6) Independent Code Consultants, Inc. 11. Resolution 9898 Entitled, “Resolution of the Council of the City of Palo Alto Authorizing the City Manager to Apply to the State of California Housing and Community Development Department for the Local Early Action Planning (LEAP) Grant for Housing Production Grant Program;” Environmental Assessment: Exempt Under the California Environmental Quality Act (CEQA) Guidelines Section 15061(b)(3). 12. Resolution 9899 Entitled, “Resolution of the Council of the City of Palo Alto Adopting the 2019 San Francisco Bay Area Integrated Regional Water Management Plan.” 13. Approval and Authorization for the City Manager or Designee to Execute Amendment Number 3 to the Memorandum of Understanding (Contract Number S17167654) With the Santa Clara Valley Water District (dba Valley Water) to Increase Funding by $50,000 and Extend the Contract Term for an Additional two Years, for a Revised Total Not-to-Exceed Amount of $305,000 Over the Five and One-half Year Term to Provide Continued Funding and Support Making Water Conservation a way of Life Through Water use Efficiency Services, Rebates, and Incentive Programs. 14. Approval and Authorization for the City Manager or Designee to Execute Contract Number C20171908 With Sedaru in a Total Not-to-Exceed DRAFT ACTION MINUTES Page 5 of 10 Final Action Minutes: 06/22/2020 Amount of $205,952 to Provide Professional Services for Wastewater Collection System Management Software and Implementation, Including $201,452 for Basic Services and up to $4,500 for Additional Services. 15. Resolution 9900 Entitled, “Resolution of the Council of the City of Palo Alto Setting the Appropriations Limit (GANN Limit) for Fiscal Year 2021.” 16. Approval of Amendment Number 1 to Contract Number C19175498 With Integrated Design 360 for Development and Support of Sustainability Implementation Plan, Green Building Program, Deconstruction and Source Separation Program, Dewatering Monitoring Program, and Utilities On-call Services for a Term Extension of One-year and Increasing Compensation for Ongoing and Approved Work by $354,230 for a Total Not-to-Exceed Amount of $930,230. 17. Approval of a Contract With O'Grady Paving, Inc., in an Amount Not-to- Exceed $2,954,031 for the FY 2020 Streets Resurfacing Project, Capital Improvements Program Projects PE-86070, PE-09003, PO-12001, and PL-12000. 18. Resolution 9901 Entitled, “Resolution of the Council of the City of Palo Alto Calling a General Municipal Election for Tuesday, November 3, 2020, for Four Council Member Seats.” 19. Approval of Contract Number C21178189 With A. Teichert & Son Inc, dba Teichert Construction, in the Amount of $13,873,053; Amendment Number 8 With C&S Engineers, Inc., Contract Number C15155208A, for the Airport Apron Reconstruction Phase III Capital Improvements Program Project AP-16000; and Approval of a Budget Amendment in Fiscal Year 2021 in the Airport Enterprise Fund. 20. Approval of Seven Five-year Contracts for On-call, as Needed, IT Project Support Services for an Annual Collective Total Not-to-Exceed Amount of $480,000; and a Five-year Collective Total Not-to-Exceed Amount of $2,400,000; and Approval of six On-call, as Needed, SAP Project Support Services, for an Annual Collective Total Not-to-Exceed Amount of $350,000 per Year, and a Five-year Collective Total Not-to-Exceed Amount of $1,750,000, With all Work Subject to Assigned Task Orders and Availability of Funds. 21. Approval of an Agreement Between the City of Palo Alto and the Midpeninsula Community Media Center, Inc, for Cablecasting, Production, and Streaming Services From July 1, 2020 Through June 30, 2023, for an Annual Amount of $160,000, With two One-year Options DRAFT ACTION MINUTES Page 6 of 10 Final Action Minutes: 06/22/2020 to Extend for a Potential Five-year Total Not-to-Exceed Amount of $800,000. 22. QUASI-JUDICIAL. 1700-1730 Embarcadero Road [20APL-00002 and 19PLN-00291]: Appeal of Director’s Approval of a Major Architectural Review to Address the Following Outstanding Issues for a Previously Approved Auto Dealership Project: Color, Landscaping, Parapets, Lighting, Transportation Demand Management Plan, County Airport Land Use Commission Review; and Floor Area Ratio. Environmental Assessment: Addendum to an Initial Study/Mitigated Negative Declaration That was Adopted for the Project on June 24, 2019, Zoning District: CS(D)(AD). 23. Approval of Three Library Contracts With: 1) Baker & Taylor for up to Six-years for a Total Amount Not-to-Exceed $2 Million for the Purchase of Library Materials and Services, 2) Ingram for up to Six-years for a Total Amount Not-to-Exceed $200,000 for Print Materials and Services, and 3) Midwest Tape for up to Six-years for a Total Amount Not-to- Exceed $700,000 for Media and Digital Materials and Services. 24. Approval of Amendment Number 1 to Contract Number C18170224 With Global Action for the Earth (the Empowerment Institute) for $45,000 for an Extension of the Community Engagement Block Program (Cool Block) and a new Electrification Initiative With the Cool Blocks and Extension of the Term to December 2021. 25. Adoption of a Record of Land Use Action (ROLUA) Approving a Change to the Local Historic Resources Inventory Classification for 235 Hamilton Avenue (Cardinal Hotel) From a Category 3 (Contributing Building) to a Category 2 (Major Building) Historic Resource. The Historic Resources Board Recommends Adoption of the ROLUA. Approval of This Historic Designation is Exempt From the California Environmental Quality Act (CEQA) in Accordance With Section 15301 of the CEQA Guidelines. 26. Adoption of an Ordinance to Reduce the Number of Human Relations Commission and Public Art Commission Members From Seven to Five. 27. Ordinance 5498 Entitled, Ordinance of the Council of the City of Palo Alto Dissolving the Library Advisory Commission by Amending Sections in Chapters 2.08 (Officers and Departments), 2.16 (Boards and Commissions Generally), and 2.24 (Library Advisory Commission) (FIRST READING: June 8, 2020 PASSED 7-0).” DRAFT ACTION MINUTES Page 7 of 10 Final Action Minutes: 06/22/2020 30A. Adoption of a Revised Compensation Plan for Management and Professional Employees, Updated Salary Schedules and Side Letters with Public Safety Unions. MOTION PASSED FOR AGENDA ITEM NUMBERS 4-8, 10, 14-19, 21-23, 26, 28, 30: 7-0 MOTION PASSED FOR AGENDA ITEM NUMBER 9: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBER 11: 6-1 Tanaka no MOTION PASSED FOR AGENDA ITEM NUMBER 12: 6-1 DuBois no MOTION PASSED FOR AGENDA ITEM NUMBER 13: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBER 20: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBER 24: 6-1 Tanaka no MOTION PASSED FOR AGENDA ITEM NUMBER 25: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBER 27: 6-1 Kou no MOTION PASSED FOR AGENDA ITEM NUMBER 29: 5-2 Kou, Tanaka no MOTION PASSED FOR AGENDA ITEM NUMBER 30A: 6-1 Tanaka no Council took a break at 9:44 P.M. and returned at 10:00 P.M. Action Items 31. PUBLIC HEARING: Adoption of the Budget Ordinance 5499 Entitled, “Ordinance of the Council of the City of Palo Alto for Fiscal Year 2021, Including Adoption of Operating and Capital Budgets and Municipal Fee Schedule;” Adoption of an Ordinance 5501 Entitled “Ordinance of the Council of the City of Palo Alto Amending Section 2.04.360 of the Palo Alto Municipal Code to Allow Council Members a Salary Waiver Option; and Review and Accept the June 30, 2019 Actuarial Valuation of the Palo Alto’s Retiree Healthcare Plan and Funding Strategy.” 32. PUBLIC HEARING: Adoption of the Following Five Resolutions: 1) Resolution 9902 Entitled, “Resolution of the Council of the City of Palo Alto Approving the Fiscal Year (FY) 2021 Electric Utility Financial Plan, Including Proposed Reserve Transfers, and Amending the Electric Utility Reserve Management Practices,” 2) Resolution 9903 Entitled, “Resolution of the Council of the City of Palo Alto Approving the FY 2021 DRAFT ACTION MINUTES Page 8 of 10 Final Action Minutes: 06/22/2020 Gas Utility Financial Plan, Including Proposed Transfers, Amending the Gas Utility Reserve Management Practices, and Adopting a Gas Rate Increase by Amending Utility Rate Schedules G-1, G-2, G-3 and G-10,” 3) Resolution 9904 Entitled, “Resolution of the Council of the City of Palo Alto Approving the FY 2021 Water Utility Financial Plan and Amending the Water Utility Reserve Management Practices,” 4) Resolution 9905 Entitled, “Resolution of the Council of the City of Palo Alto Amending Utility Rate Schedule D-1 Increasing the Storm Water Management Fee by 2.5 Percent per Month per Equivalent Residential Unit for FY 2021,” and 5) Resolution 9906 Entitled, “Resolution of the Council of the City of Palo Alto Amending Utility Rate Schedules EDF-1 and EDF-2 to Increase Dark Fiber Rates 2.5 Percent.” AGENDA ITEMS NUMBERS 31 AND 32 WERE HEARD TOGETHER Public Hearing opened at 10:30 P.M. Public Hearing closed at 11:04 P.M. MOTION: Council Member Kniss moved, seconded by Council Member Filseth to move Agenda Item Number 33 to the June 23, 2020 Action Agenda. MOTION PASSED: 5-2 Cormack, Fine no MOTION: Council Member Kniss moved, seconded by Vice Mayor DuBois to fund KZSU at $20,000 for Fiscal Year 2021. MOTION FAILED: 3-4 Cormack, Filseth, Fine, Tanaka no MOTION: Council Member Cormack moved, seconded by Council Member Filseth to: A. Adopt the Fiscal Year 2021 Budget Ordinance, which includes: i. City Manager’s Fiscal Year 2021 Proposed Operating and Capital Budgets, previously distributed at the April 20th City Council Meeting; ii. Amendments to the City Manager’s Fiscal Year 2021 Proposed Operating Budget; iii. Amendments to the City Manager’s Fiscal Year 2021 Proposed Capital Budget; iv. Allocated Charge Amendments to the City Manager’s Fiscal Year 2021 Proposed Operating and Capital Budgets; DRAFT ACTION MINUTES Page 9 of 10 Final Action Minutes: 06/22/2020 v. Fiscal Year 2021 City Table of Organization; and vi. Fiscal Year 2021 Municipal Fee Changes; B. Adopt the Ordinance Amending Section 2.04.360 of the Palo Alto Municipal Code to Allow Council Members a Salary Waiver Option; C. Accept the Fiscal Year 2021 – 2025 Capital Improvement Plan; D. As recommended by the Finance Committee at the May 5, 2020 meeting (CMR 11284), accept the June 30, 2019 biennial actuarial valuation of Palo Alto’s Retiree Healthcare Plan and approve full funding of the Actuarial Determined Calculation (ADC) for Fiscal Year 2021 and Fiscal Year 2022 using a 6.25% Discount Rate for the calculation; and E. Approve and adopt Resolutions of the City Council of the City of Palo Alto: i. Approving the Fiscal Year 2021 Electric Utility Financial Plan, including reserve transfers, and amending the Electric Utility Reserve Management Practices; ii. Approving the Fiscal Year 2021 Gas Utility Financial Plan, including reserve transfers, amending the Gas Utility Reserve Management Practices, and adopting a Gas Rate Increase by Amending Utility Rate Schedules G-1, G-2, G-3 and G-10; iii. Approving the Fiscal Year 2021 Water Utility Financial Plan, including reserve transfers, and amending the water Utility Reserve Management Practices; and iv. Amending Utility Rate Schedule D-1 increasing the Storm Water Management Fee by 2.5 percent per month per Equivalent Residential Unit for Fiscal Year 2021; and v. Amending Utility Rate Schedules EDF-1 and EDF-2 to increase Dark Fiber Rates 2.5 percent. MOTION SPLIT FOR THE PURPOSE OF VOTING MOTION PART A PASSED: 5-2 Kou, Tanaka no MOTION PART B PASSED: 7-0 MOTION PART C PASSED: 5-2 Kou, Tanaka no DRAFT ACTION MINUTES Page 10 of 10 Final Action Minutes: 06/22/2020 MOTION PART D PASSED: 7-0 MOTION PART E PASSED: 6-1 Tanaka no Vice Mayor DuBois left the meeting at 12:07 A.M. 33. PUBLIC HEARING / QUASI-JUDICIAL. 488 University Avenue [19PLN- 00038]: Request for a Waiver From Title 18 to Allow Conversion of a Residential use to a Hotel use to Accommodate 100 Guestrooms. In Addition, the Applicant Requests Approval of an Architectural Review and Historic Review Application for Interior and Exterior Renovations to the Hotel President to This Category 2 Historic Building, as Well as a Parking Adjustment to Accommodate the Conversion to a Hotel use. The Project Also Includes a Conditional Use Permit to Allow for Restoration and use of a Historic Rooftop Garden and for the On-site Sale of Alcoholic Beverages. Proposed Revisions Include Structural and Seismic Retrofit of the Existing Structure. Zone District: Downtown Commercial District With Ground Floor and Pedestrian Overlays (CD-C)(GF)(P). Environmental Assessment: Exempt From the Provisions of the California Environmental Quality Act (CEQA) Pursuant to Guidelines Sections 15332 (In-fill Development), 15331 (Historical Resource Restoration/Rehabilitation), 15301 (Existing Facilities), and 15302 (Replacement or Reconstruction). (THIS ITEM IS CONTINUED TO JUNE 23, 2020). 34. Approval of Special Amendments to the Employment Agreements between the City of Palo Alto and Council Appointed Officers Specifically the City Attorney and the City Manager. MOTION: Council Member Kniss moved, seconded by Council Member Filseth to approve and authorize the Mayor to execute the following contract amendments for Council Appointed Officers: A. Amendment Number Eight to employment agreement between the City of Palo Alto and Molly S. Stump; and B. Amendment Number Two to employment agreement between the City of Palo Alto and Ed Shikada. MOTION PASSED: 5-1 Tanaka no, DuBois absent Adjournment: The meeting was adjourned at 12:33 A.M. CITY OF PALO ALTO CITY COUNCIL DRAFT ACTION MINUTES Page 1 of 6 Special Meeting June 23, 2020 The City Council of the City of Palo Alto met on this date via Virtual Teleconference at 5:02 P.M. Participating Remotely: Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Absent: Special Orders of the Day 1. Appointment of two Candidates to the Utilities Advisory Commission for Three-year Terms Ending May 31, 2023. First Round of voting for two positions on the Utilities Advisory Commission for Three-year Terms Ending May 31, 2023. Voting For: Claude Ezran Voting For: Lisa Forssell Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Voting For: Phil Metz Voting For: Lauren Segal Cormack, DuBois, Filseth, Fine, Kniss, Kou, Tanaka Mayor Fine announced that Lisa Forssell with 7 votes, and Lauren Segal with 7 votes were appointed to the Utilities Advisory Commission. Consent Calendar MOTION: Mayor Fine moved, seconded by Council Member Cormack to approve Agenda Item Numbers 2-4A. 2. Authorize the City Manager to Place "Black Lives Matter" on a City Street Near Palo Alto City Hall. 3. Approval of a Lease Agreement Between Palo Alto Unified School District (PAUSD) and the City of Palo Alto for the Cubberley Community Center for 54 Months, Not-to-Exceed $2,733,280 per Year. FINAL ACTION MINUTES Page 2 of 6 City Council Meeting Final Action Minutes: 06/23/2020 4. Adoption of a Resolution 9907 Entitled, “Resolution of the Council of the City of Palo Alto Continuing the Proclamation of Local Emergency due to COVID-19.” 4A. (FORMER AGENDA ITEM NUMBER 9). Approval of Amendment Number 2 to Contract Number C18171057 With AECOM for Continued and Expanded Services for the Connecting Palo Alto Rail Grade Separation, PL-17001, Effort and to Increase Compensation by $309,872 for a Total Not-to-Exceed Amount of $2,794,658; and Approval of an Updated Rail Workplan (THIS ITEM WAS MOVED TO CONSENT BY A MOTION OF THE COUNCIL ON JUNE 22, 2020). MOTION PASSED: 7-0 Action Items 4B. PUBLIC HEARING / QUASI-JUDICIAL. 488 University Avenue [19PLN00038]: Request for a Waiver From Title 18 to Allow Conversion of a Residential use to a Hotel use to Accommodate 100 Guestrooms. In Addition, the Applicant Requests Approval of an Architectural Review and Historic Review Application for Interior and Exterior Renovations to the Hotel President to This Category 2 Historic Building, as Well as a Parking Adjustment to Accommodate the Conversion to a Hotel use. The Project Also Includes a Conditional Use Permit to Allow for Restoration and use of a Historic Rooftop Garden and for the On-site Sale of Alcoholic Beverages. Proposed Revisions Include Structural and Seismic Retrofit of the Existing Structure. Zone District: Downtown Commercial District With Ground Floor and Pedestrian Overlays (CDC)(GF)(P). Environmental Assessment: Exempt From the Provisions of the California Environmental Quality Act (CEQA) Pursuant to Guidelines Sections 15332 (In-fill Development), 15331 (Historical Resource Restoration/Rehabilitation), 15301 (Existing Facilities), and 15302 (Replacement or Reconstruction)(THIS ITEM WAS CONTINUED FROM JUNE 22, 2020). Public Hearing opened at 6:26 P.M. Public Hearing closed at 6:43 P.M. Council took a break at 6:43 P.M. and returned at 6:59 P.M. MOTION: Mayor Fine moved, seconded by Council Member Kniss to: A. Grant a waiver to allow conversion of a downtown residential use to a hotel use; FINAL ACTION MINUTES Page 3 of 6 City Council Meeting Final Action Minutes: 06/23/2020 B. Approve the requested architectural review, historic review, parking adjustment, and conditional use permit applications, and the associated environmental exemption findings; C. Direct Staff to update in-lieu parking requirements and fees prior to issuance of a building permit; D. Remove condition 58; E. Add a condition to prevent office conversion; and F. Expand the condition to prevent amplified sound on the roof deck. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to the Motion, Part E, “and provide a waiver for all residential uses.” INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to combine Motion, Parts A and E, to read, “Direct Staff to update findings and impose conditions as appropriate, granting a waiver to allow the conversion from rental housing to a hotel use or residential use, and prohibiting the conversion into non-hotel commercial uses, including offices;” MOTION AS AMENDED RESTATED: Mayor Fine moved, seconded by Council Member Kniss to: A. Direct Staff to update findings and impose conditions as appropriate, granting a waiver to allow the conversion from rental housing to a hotel use or residential use, and prohibiting the conversion into non-hotel commercial uses, including offices; B. Approve the requested architectural review, historic review, parking adjustment, and conditional use permit applications, and the associated environmental exemption findings; C. Direct Staff to update in-lieu parking requirements and fees prior to issuance of a building permit; D. Remove condition 58; and E. Expand the condition to prevent amplified sound on the roof deck. MOTION AS AMENDED PASSED: 6-1 Kou no FINAL ACTION MINUTES Page 4 of 6 City Council Meeting Final Action Minutes: 06/23/2020 MOTION: Mayor Fine moved, seconded by Council Member Kniss to direct the City Attorney to prepare a public memo explaining the legal rules that applied to the Council’s consideration and decision on the President Hotel, and publish it on the City’s website. MOTION PASSED: 6-1 Kou no Council took a break at 8:56 P.M. and returned at 9:07 P.M. 5.PUBLIC HEARING: Adoption of a Resolution 9908 Entitled, “Resolution of the Council of the City of Palo Alto to Suspend Assessments for Fiscal Year 2021 on the Downtown Palo Alto Business Improvement District.” Public Hearing opened at 9:08 P.M. Public Hearing closed at 9:10 P.M. MOTION: Council Member Kniss moved, seconded by Vice Mayor DuBois to adopt a Resolution temporarily suspending the levy of assessments in Fiscal Year 2021 in connection with the Downtown Palo Alto Business Improvement District (BID). MOTION PASSED: 5-2 Filseth, Kou no 6.Discuss the Parks and Recreation Commission's Pilot Program to Increase Access to Foothills Park for Nonresidents and Provide 3 June 23, 2020 Direction to Staff (THIS ITEM WAS CONTINUED BY COUNCIL ON JUNE 22, 2020 TO A DATE IN AUGUST) 7.Urgency Interim Ordinance 5500 Entitled, “Urgency Interim Ordinance of the City of Palo Alto Temporarily Allowing Expansion of Outdoor Dining, Retail, and Other Activities on Public and Private Property; Relaxing Regulations Regarding: 1) Onsite Parking, 2) On-sale and Consumption of Alcohol, 3) Design/Architectural Review, and 4) Permit Fees to Facilitate Such Outdoor use”; and Adoption of a Resolution 9909 Entitled, “Resolution of the Council of the City of Palo Alto Authorizing Temporary Street Closures of California Avenue, University Avenue and Adjacent Downtown Blocks; and Approving a Temporary Pilot Parklet Program Including Standards and Requirements.” MOTION: Council Member Kniss moved, seconded by Council Member Cormack to: A. Adopt an Interim Urgency Ordinance Temporarily Allowing Expansion of Outdoor Dining, Retail, and Other Activities on Public and Private Property and Relaxing Regulations Regarding Onsite Parking, On-sale FINAL ACTION MINUTES Page 5 of 6 City Council Meeting Final Action Minutes: 06/23/2020 and Consumption of Alcohol, Design/Architectural Review, and Permit Fees, All to Facilitate Such Outdoor Use During the COVID-19 State of Emergency, With the Ordinance to Take Effect Immediately Upon Adoption; and B. Adopt a Resolution Temporarily Closing Portions of California Avenue and University Avenue and Certain Downtown Streets Intersecting University Avenue Pursuant to California Vehicle Code Section 21101 and Approving a Pilot Parklet Demonstration Program Including Parklet Design Requirements, All to Facilitate Outdoor Dining and Retail. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to add to Motion, Part B, “…and to encourage Staff to accommodate low-cost parklet options.” MOTION AS AMENDED RESTATED: Council Member Kniss moved, seconded by Council Member Cormack to: A. Adopt an Interim Urgency Ordinance Temporarily Allowing Expansion of Outdoor Dining, Retail, and Other Activities on Public and Private Property and Relaxing Regulations Regarding Onsite Parking, On-Sale and Consumption of Alcohol, Design/Architectural Review, and Permit Fees, All to Facilitate Such Outdoor Use During the COVID-19 State of Emergency, With the Ordinance to Take Effect Immediately Upon Adoption; and B. Adopt a Resolution Temporarily Closing Portions of California Avenue and University Avenue and Certain Downtown Streets Intersecting University Avenue Pursuant to California Vehicle Code Section 21101 and Approving a Pilot Parklet Demonstration Program Including Parklet Design Requirements, All to Facilitate Outdoor Dining and Retail; and to encourage Staff to accommodate low-cost parklet options. MOTION AS AMENDED PASSED: 7-0 8. Discussion and Direction to Staff on Housing Affordability Requirements for Projects Proposed Under the Planned Home Zoning (PHZ) (Planned Community Zoning) (THIS ITEM WAS CONTINUED BY COUNCIL ON JUNE 22, 2020 TO A DATE IN AUGUST) 9. Approval of Amendment Number 2 to Contract Number C18171057 With AECOM for Continued and Expanded Services for the Connecting Palo Alto Rail Grade Separation, PL-17001, Effort and to Increase Compensation by $309,872 for a Total Not-to-Exceed Amount of FINAL ACTION MINUTES Page 6 of 6 City Council Meeting Final Action Minutes: 06/23/2020 $2,794,658; and Approval of an Updated Rail Workplan (THIS ITEM HAS BEEN MOVED TO CONSENT) Adjournment: The meeting was adjourned at 11:43 P.M. City of Palo Alto (ID # 11130) City Council Staff Report Report Type: Consent Calendar Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: 60kV Breaker Design/Build Project Title: Approve and Authorize the City Manager or Designee to Execute Contract Number C20176772 With Burns & McDonnell in an Amount Not-to- Exceed of $690,000 for the 60kV Breaker Replacement Design/Build Implementation, Capital Project EL-17002; and Authorization to Negotiate and Execute Related Change Orders in the Amount of $103,500, for a Total Not-to-Exceed Amount of $793,500 From: City Manager Lead Department: Utilities Staff Recommends that Council: 1. Approve and authorize the City Manager or designee to execute a contract with Burns & McDonnell (Attachment A) in an amount not-to-exceed of $690,000, for design, purchase, and installation of four new 60kV circuit breakers, to replace existing equipment as part of the Substation 60kV Breaker Replacement (WBS EL-17002) Capital Improvement Project. 2. Authorize the City Manager or his designee to negotiate and execute one or more change orders to the contract with Burns & McDonnell for related additional, but unforeseen work which may develop during the project; the total will not exceed $103,500 or 15% of total contract the total not-to-exceed (NTE) amount for the contract is $793,000. Background City of Palo Alto Utilities (CPAU) owns and operates the electric system serving approximately 30,000 customers. The City receives power over PG&E transmission lines at 115,000 volts (115 kV) and transforms this to 60,000 volts (60 kV) to feed the city’s sub-transmission system linking nine distribution substations. Thirty-eight 60 kV circuit breakers exist within these substations. These devices are critical for isolating short circuits/faults, protecting other equipment from damage during faults, and reconfiguring power flow during outages or maintenance. Of the 38 circuit breakers, staff has identified 22 as high priority for replacement. Six circuit breakers are over 60 years old, three are over 50 years old, and seven will be 50 years old in City of Palo Alto Page 2 2022. Typically, this equipment has a reliable useful life between 40-50 years. Additionally, staff performed electric system analysis and identified six breakers that are electrically under- rated for the maximum amount of electrical current anticipated during faults on the system. Four of the under-rated breakers will be replaced under this contract. Discussion These replacements will improve the resiliency and reliability of the City’s electrical sub- transmission system by replacing aged or under-rated electric equipment, to ensure proper operation and protection of the electric system. Replacing these circuit breakers will provide better protection and improve the resiliency of the City’s electric sub-transmission system as the new breakers have a higher likelihood of operating properly in the event of a fault and seamlessly restoring power as necessary. Currently, the standard insulation for these circuit breakers is Sulfur Hexafluoride (SF6) gas. CPAU complies with California Air Resources Board regulations for monitoring and reducing SF6 emissions from gas insulated equipment. Two of these four breakers have already been purchased as part of a procurement program in 2018 and are SF6 type. The remaining two will be procured by Burns & McDonnell and will be ‘dry-air’ type insulated breakers. Dry-air breakers use environmentally friendly air, which is becoming the new regulated standard, but at a higher cost of approximately 100% more. In this contract, four circuit breakers at Colorado Avenue and Park Boulevard Substations are earmarked for replacement. The design/build award for this project was approved by the Utilities Director and the City Manager. Work includes preparation of electrical schematic and wiring diagrams; design and construction of the foundation; procurement of the new circuit breaker equipment using CPAU specifications; and installation, testing, and commissioning of the equipment for a turn-key implementation. Staff recommends adding a 15% contingency amount to the contract because this is the first time we are contracting a design/build for this type of project, additional items typically surface during the detailed design phase which is something that our diligent, up-front, pre-design may not fully identify during scope development, and to ensure the dry-air technology is employed correctly and fully, in line with Council goals of greenhouse gas reduction. City of Palo Alto Page 3 Solicitation Process On March 10, 2020, a notice soliciting bids for a Request for Proposals (RFP) for the Design/Build replacement of 60kV Circuit Breakers was posted at City Hall and on the Planet Bids portal. The Design/Build process was selected because internal staffing and resources are not adequate to facilitate the entire process within the limited time constraint; and because having one firm responsible and accountable for design and build lessens the opportunity for errors when these critical assets are placed in service. The solicitation was open for six weeks and bids were received from two qualified bidders on April 22, 2020. Summary of Solicitation Process Proposal Title 60kV Breaker Design Build Proposal Number 176772 Proposed Length of Project 12 months Number of Proposal packages downloaded 878 Total Days to Respond to Proposal 43 Number of Proposals Received 2 Proposal Costs Range $616,000 to $690,000 Company Name Location (City, State) Amount Burns & McDonnell Brea, California $690,000 Cost of Services The following criteria were used during the evaluation process to identify the successful proposer. Burns & McDonnell was selected over the lower cost proposal for scoring significantly higher on all criteria besides cost, and is a full-service engineering/procurement/construction firm whom CPAU has used prior for other projects. We are confident they have the full design/build capability that will perform better than a company whose main service is construction and does not have as much design and build experience as Burns & McDonnell. City of Palo Alto Page 4 Evaluation criteria included: • Quality of the proposal • Quality, performance, and effectiveness of the solution • Proposer’s experience • Cost to the City • Proposer’s financial stability • Proposer’s compliance to technical specifications and commercial terms • Proposer’s ability to perform the contract within the time specified • Proposer’s prior record of performance with city or others • Any other factor the city deems relevant as specified in the request for proposals Resource Impact There is $600,000 available in the budget for capital project EL-17002 (Substation 60kV Breaker Replacement). There is funding remaining in Fiscal Year 2020 that will be requested for reappropriation through the year-end process. This amount will be reappropriated to sufficiently fund the total NTE contract amount of $793,000 in Fiscal Year 2021. CPAU Engineering and Operations staff will support the design and installation of the four new 60kV circuit breakers with design review, inspections, and safety observations. Staff reviewed the costs, going over each line-item with the Proposer to ensure the pricing was fair and competitive, based on experience and comparison with the other proposal. Policy Implications The approval of this Enterprise Fund professional services contract is consistent with existing City policies. This recommendation is consistent with the Council-approved Utilities 2018 Strategic Plan (Staff Report 9022), especially the strategic objective to: “Establish a proactive infrastructure replacement program, based on planned replacement before failure to support reliability and resiliency.” This contract is on the City’s design/build contract template, which permits the City to terminate without cause for convenience by providing written notice to the contractor. In the event the City finds itself facing a challenging budget situation, and it is determined that City resources need to be refocused elsewhere, the City can terminate for convenience. Other options include termination due to non-appropriation of funds or amending the contract to reduce the cost, for example, by reducing the scope of work. The contract may also be temporarily suspended by written notice of the City Manager. Stakeholder Engagement Given the nature of this work, primary stakeholders are contractors. Outreach and engagement was managed through the RFP solicitation process described above. City of Palo Alto Page 5 Environmental Review Approval of the attached contract is categorically exempt from review under the California Environmental Quality Act (CEQA) pursuant to Section 15302 (replacement or reconstruction of existing facilities) of the CEQA Guidelines. 1 of 1 TO: HONORABLE CITY COUNCIL FROM: DEAN BATCHELOR, DIRECTOR OF UTILITIES DATE: AUGUST 03, 2020 SUBJECT: AGENDA ITEM NUMBER 5- Approve and Authorize the City Manager or Designee to Execute the Following Utilities Communication, Graphic Design and Marketing Services Contracts in a Combined Not-to-Exceed Amount of $200,000 Annually and a Combined Not-to Exceed Amount of $1,000,000 Over a Five-year Term: A) Eric Goldsberry Art Direction, C20176172A; B) Marketing for Change, C20176172B; and C) Underground Advertising, C20176172C; Finding of CEQA Exemption The item has been pulled in order to allow Staff time to acquire comparative budget information/benchmarks from other utilities on these types of services. _______________________ _______________________ Dean Batchelor Ed Shikada Director of Utilities Department City Manager 5 City of Palo Alto (ID # 11385) City Council Staff Report Report Type: Consent Calendar Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: 3000 Alexis Drive (Golf Course Renovation) Title: QUASI-JUDICIAL. 3000 Alexis Drive [19PLN-00304]: Approval of the Record of Land Use Action (RLUA) Approving the Proposed Project and Site and Design Review Application for the Palo Alto Hills Golf and Country Club to Renovate the 18-hole Golf Course. Environmental Assessment: Exempt From CEQA Pursuant to Guidelines Section 15304 (Minor Alterations to Land). Zoning District: OS (Open Space) From: City Manager Lead Department: Planning and Development Services Recommendation Staff and the PTC recommend that the City Council take the following action(s): 1. Approve the attached Record of Land Use Action (RLUA) for the proposed project based on the findings and subject to the conditions of approval. The RLUA was reviewed by the Planning and Transportation Commission and recommended for approval (6-0-1, Riggs absent). Executive Summary Palo Alto Hills Golf & Country Club (Club) proposes a two-phase renovation to the 18-hole, 128.58-acre golf course. The renovation of the 1961 course would include grading to update the existing greens, tees, and sand bunkers, using current design techniques. The Club seeks to improve playing conditions, drainage, and maintenance of the course and reduce the amount of impervious coverage on the site. Commercial Recreation is a conditionally permitted use within the OS zone district. The site is subject to a CUP for the operation of the club. The club is not requesting amendments to the restrictions contained in the existing CUP nor are there any proposed City of Palo Alto Page 2 changes to the capacity of the golf course or the clubhouse. The existing CUP was approved in 2008 via a RLUA.1 The applicant has also, in response to comments made by the Planning and Transportation Commission (PTC), conducted an assessment of the existing parking lot trees and found that three Chinese Pistache trees need to be replaced due to poor health. The applicant has proposed four new Coast Live Oaks to be planted in the parking lot in addition to the replacement Chinese Pistache to increase the tree canopy over the lot. Now the project includes the removal of 39 trees, including four protected trees, and the planting of 136 trees. The Council’s action is the final part of the Site and Design Review process. In brief, the purposes of this process are to: a) Ensure construction and operation of the use in a manner that will be orderly, harmonious, and compatible with existing or potential uses of adjoining or nearby sites. b) Ensure the desirability of investment, or the conduct of business, research, or educational activities, or other authorized occupations, in the same or adjacent areas. c) Ensure that sound principles of environmental design and ecological balance shall be observed. d) Ensure that the use will be in accord with the Palo Alto Comprehensive Plan. Background The proposed renovation would update the golf course features and infrastructure, including the existing greens, fairways, tees, and bunker complexes. The use of current green rebuilding techniques and design principles will improve playing conditions and drainage while reducing the need for maintenance. The facilities would be updated following the United States Golf Association (USGA) guidelines. Grading activities would involve 39,750 cubic yards of soil, balancing cut, and fill resulting in a net-zero change. No truck hauls of soil are necessary to and from the site. The construction of the proposed project would be divided into two nine-hole phases. Additional infrastructure improvements include updating the irrigation system and replacing certain golf cart pathways with permeable surfaces. Current practice facilities would be upgraded, including the chipping and putting greens, and adding a new short game green. A proposed patio expansion with flatwork on the course side of the clubhouse will reduce the impervious footprint. The overall impervious surface area on the site will be reduced by 14,402 square feet (sf). PTC Review 1Link to CMR October 20, 2008: https://www.cityofpaloalto.org/civicax/filebank/documents/13816; https://www.cityofpaloalto.org/civicax/filebank/documents/13419 City of Palo Alto Page 3 On April 29, 2020, the PTC moved approval of the staff recommendation with a vote of 6-0-1 (Riggs absent) with no additional conditions. However, the PTC did discuss the existing parking lot and their interest in additional tree plantings within that area. In regards to the golf course itself, the applicant clarified that all trees to be removed trees are non-native pines and planted trees will be per the City’s replacement ratios. The Commissioners noted they appreciated that the project would improve green space, would not involve off-site truck trips, and would add oak trees. The PTC did comment on the conditions of the parking lot in terms of shading and planted trees, though there was no requirement to address this in the motion by PTC.2 Discussion The PTC concurred with staff analysis that the project complies with the criteria included in the policy objectives set forward in the municipal code and Comprehensive Plan. Specifically, the Draft Record of Land Use Action (Attachment B) provides tailored findings for Site and Design Review approval of the project. In addition, PAMC Section 18.28.070 Additional OS District Regulations, Section (p) Open Space Review Criteria, sets forth 12 review criteria taken from the Comprehensive Plan Natural Environment Element. The attached Draft Record of Land Use Action reflects staff’s analysis of the project’s compliance with these criteria. • Policy L-1: Limit future urban development to currently developed lands within the urban service area. The boundary of the urban service area is otherwise known as the urban growth boundary. Retain undeveloped land west of Foothill Expressway and Junipero Serra as open space, with allowances made for very low-intensity development consistent with the open space character of the area. Retain undeveloped land northeast of Highway 101 as open space. • Policy N-1.8. Minimize impacts of any new development on the character of public open space and the natural ecology of the hillsides. • Policy N-1.9. All development in the foothill portion of the Planning Area (i.e., above Junipero Serra Boulevard) should visually blend in with its surroundings and minimize impacts to the natural environment. As such, development projects should: o Not be visually intrusive from public roadways and public parklands. o Be located away from hilltops. o Be clustered, or closely grouped, in relation to the area surrounding to reduce conspicuousness, minimize access roads, and to reduce fragmentation of natural habitats. 2 Link to PTC staff report - https://tinyurl.com/PTC3000Alexis.; PTC minutes - https://tinyurl.com/MTPTC3000Alexis City of Palo Alto Page 4 o Include built forms and landscape forms that mimic the natural topography. o Retain existing vegetation as much as possible. o Utilize natural materials and earth tone or subdued colors. o Include landscaping composed of native species that require little or no irrigation. o Include exterior lighting that is low-intensity and shielded from view. o Include access roads of a rural rather than urban character. Zoning Compliance3 The proposed project complies with applicable codes for the subject site and design application, but does have some existing noncompliant aspects with regard to the zoning code related to the amount of impervious area and parking lot shading requirement. These code requirements changed after the golf course was first approved and is not required to make changes to meet the more current standard. However the proposed renovation includes an overall net reduction of impervious area by 6.25%. The project does not constitute an expansion of the Club property or facilities. Therefore, the project does not require an amendment to the Conditional Use Permit (CUP). The City Council modified the CUP in 2008 with City Council approval in conjunction with a Site and Design Review approval (CMR 413:08) for a new fitness center and other improvements. The CUP restricts the Club membership numbers (425 proprietary members and 200 social members), events, and addressed other aspects, including the Transportation Demand Management (TDM) program.4 Following the PTC’s interest regarding increased shade and trees in the parking lot. The applicant worked with staff to propose four additional native Coast Live Oaks along the hillside area of the parking lot closest to the Club House. In addition, the applicant will replace three existing Chinese Pistache trees that are in poor health. These additional tree plantings and replacement locations within the parking lot area are indicated in the image below. 3 The Palo Alto Zoning Code is available online: http://www.amlegal.com/codes/client/palo-alto_ca 4 Link to CMR October 20, 2008: https://www.cityofpaloalto.org/civicax/filebank/documents/13816; https://www.cityofpaloalto.org/civicax/filebank/documents/13419 City of Palo Alto Page 5 With the additional parking lot tree planting presented by the applicant, staff believes that the comments brought up by the PTC have been addressed. As such, the Draft Record of Land Use Action has been adjusted to include the additional scope for the parking lot trees. Summary of Key Issues Pursuant to PAMC Section 18.28.050(b), Table 3, the maximum impervious coverage for the site is 182,845 sf. The Council previously approved 364,507 sf of impervious surface coverage, which includes buildings, parking lot area, and golf cart pathways. The proposed project would result in a 14,209 square foot reduction of impervious coverage, for a new total impervious area of 350,298 sf. Additionally, the project is focused primarily on improvements to the golf course area where there is little impervious area already. When the PTC reviewed the project they had minor comments none of which suggested significant changes to the project and found that the improvements proposed met all of the environmental sensitive regulations in terms of open space, planting of native trees, water usage, and balancing the cut and fill for grading on-site reducing the need for trucks to bring soil onto the site or taking it away. The proposed changes bring the site further into compliance with the Municipal Code regulations. Tree Protection and Planting An arborist report provides a survey of the trees on site as to their health, status as regulated or protected trees, and measures to follow for tree protection during construction activities. Each tree is numbered, and recommendations are provided for tree protection during construction, City of Palo Alto Page 6 and to ensure long-term health. The site includes 71 protected trees5. Of these, four are proposed for removal. The remaining protected trees will benefit from tree protection measures or would not be impacted by the construction activity. Thirty-five non-protected trees are proposed for removal because they are diseased, represent a safety hazard, are non- native species, or would interfere with grading activities (or a combination of these factors). The tree removals are shown on Sheet 5 of the project plans. The project includes the planting of 132 trees (62 Coast Redwoods, 61 Coast Live Oaks, and nine Valley Oaks) throughout the project area. A supplemental arborist report was provided (Attachment D) by the applicant for the assessment of existing parking lot trees and the recommendation for replacing three existing Chinese Pistache in poor health and adding four new Coast live Oaks in the parking lot area, bringing the new tree total to 136 trees (total of 65 Coast Live Oaks for the project overall). The additional parking lot tree planting and replacements will bring the site into greater compliance with the City’s parking lot shading requirements. Multi-Modal Access, Parking, and TDM The parking lot and driveways to the site will remain unchanged and in compliance with previous approvals. The project does not result in the need for additional parking spaces. A TDM plan was required for the Club as part of the 2008 project. The project does not include any increases in facility square footage or expansion of the Club House, as such, the project would not necessitate changes to the TDM plan. Policy Implications There are no significant policy implications associated with this recommendation. Resource Impact The recommendation has no significant fiscal or budget impact. Timeline This project was submitted to the Planning & Development Service Department on September 9, 2019, for Site and Design Review. After the application was thoroughly reviewed by City staff, it was deemed complete on February 26, 2020. The Planning & Transportation Commission (PTC) reviewed the application on April 29, 2020, where they recommended approval of the draft Record of Land Use Action (RULA) with minor comments regarding parking lot tree canopy. 5 Protected Tree means (1) Any tree of the species Quercus agrifolia (Coast Live Oak) or Quercus lobata (Valley Oak) which is eleven and onehalf inches in diameter (thirty-six inches in circumference) or more when measured four and one-half feet (fifty-four inches) above natural grade; and (2) Any Redwood tree (species Sequoia sempervirens) that is eighteen inches in diameter (fifty-seven inches in circumference) or more when measured four and one-half feet (fifty-four inches) above natural grade, and (3) A heritage tree designated by the city council in accordance with the provisions of this chapter. (PAMC Chapter 8.10 Section 8.10.020 Definitions) City of Palo Alto Page 7 Stakeholder Engagement This item was noticed prior to the PTC hearing on April 29, 2020, where notices of that public hearing for this project was published in the Daily Post on April 15, 2020, which is 14 days in advance of the meeting. Postcard mailing occurred on April 15, 2020, which is 14 days in advance of the meeting. Public Comments As of the writing of this report, no project-related, public comments were received. Environmental Review The subject project has been assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. Specifically, the project is Categorically Exempt pursuant to CEQA Guideline 15304 (Minor Alterations to Land), since grading would occur on land with a slope less than 10%. The average grade of the slope for the site is 8.8%. As noted above, the project proposes to remove four protected trees due to the poor health and safety risks. Additionally, the project is proposing to remove 35 non-native trees, plant 136 redwood and oak trees, and replace three Chinese Pistache trees in the parking lot. Several of the trees are to be planted to frame views of the hillsides and provide screening. Conditions of approval ensure that in the unlikely event of any archaeological resource discovery, protocols are in place. Proposed grading would result in a net zero cut/fill amount. Attachments: Attachment A: Location Map Attachment B: Draft Record of Land Use Action Attachment C: Zoning Comparison Table Attachment D: Arborist Report for Parking Lot Area Attachment E: Project Plans Webpage ACTION NO. 2020-____ RECORD OF THE COUNCIL OF THE CITY OF PALO ALTO LAND USE ACTION FOR 3000 ALEXIS DRIVE: SITE AND DESIGN REVIEW [19PLN-00304] On ____________, 2020, the Council of the City of Palo Alto approved the Site and Design Review application for the renovation of an existing golf course facility, including the addition of flat work for a patio, construction of a trash enclosure, grading and updating fairways, greens and tees and associated improvements, including removal of 39 trees and planting of 132 trees, on a 128.58 acre parcel in the Open Space Zone District, making the following findings, determination and declarations: SECTION 1. Background. A. Jeffrey Froke of Golfauna on behalf of Palo Alto Hills Golf & Country Club, Inc., property owner, requested the City’s approval to allow the renovation of an existing golf course facility, including the addition of flat work for a patio, construction of a trash enclosure, grading and updating fairways, greens and tees and associated improvements on a 128.58 acre parcel (“The Project”). B. The project site is a single parcel (APN 182-35-035 & 182-35-008) of 128.58 acres in size in the Palo Alto Foothills. The site is developed, containing an existing golf and tennis club operating an 18-hole golf course, three tennis courts, swimming pool, clubhouse and maintenance facility. The site is designated on the Comprehensive Plan land use map as Open Space and is located within Open Space (OS) zoning district. The project includes the phased rehabilitation of the golf course fairways, greens, tees, the addition of practice greens, trash enclosure, and flatwork to create a patio adjacent to the clubhouse. The construction of the patio would result in a reduction of impervious surface coverage. Certain golf cart paths will have their surfaces replaced also resulting in a reduction of impervious surfaces. The total impervious area (including building foot print and other hardscape areas) would be 350,298 square feet (a reduction of 14,209 square feet). C. Following staff review, the Planning and Transportation Commission (Commission) reviewed and recommended approval (on a 6-0-1 vote) of the Project on April 29, 2020. The Commission’s recommendations are contained in CMR 11385 and the attachments to it. D. On _____ 2020, the City Council reviewed the project design. After hearing public testimony, the Council voted to approve the project pursuant to the findings set forth in Sections 3 and 4 and subject to the conditions set forth in Section 6 of this Record of Land Use Action. SECTION 2. Environmental Review. The City as the lead agency for the Project has determined that the project is subject to environmental review under provisions of the California Environmental Quality Act (CEQA) under Guideline section 15304, Minor Alterations to Land, since grading would occur on land with a slope less than 10%. SECTION 3. Site and Design Review Findings 1. The use will be constructed and operated in a manner that will be orderly, harmonious, and compatible with existing or potential uses of adjoining or nearby sites. The project is a renovation of an existing golf course and tennis club. Portions of the project site are adjacent to properties with single-family residences. Other portions of the property abut a natural preserve area. Views of the golf course from the adjacent roadways are limited and some rear yards of the neighboring residences have views of the property. The project includes planting 132 trees on site and removal of 39 trees. It is expected with the completion of the project, the property will continue to operate in a similar harmonious way as it has in the past. 2. The project is consistent with the goal of ensuring the desirability of investment, or the conduct of business, research, or educational activities, or other authorized occupations, in the same or adjacent areas. The golf course and tennis club has been in existence since the 1960s. The project will upgrade the facility using current design standards improving the playing conditions, reducing maintenance and the long-term viability of the club. 3. Sound principles of environmental design and ecological balance are observed in the project. The project has been designed to minimize the impact on the environment. Grading activities will keep the soil onsite and result in a net zero cut/fill grading. Drainage and irrigation will be improved and as a result maintenance activities can be reduced. Four protected trees are proposed for removal, 35 non-native trees are removed and 132 redwoods and oaks are proposed to be planted. 4. The use will be in accord with the Palo Alto Comprehensive Plan. The project proposal complies with the policies of the Land Use and Community Design and the Natural Environment elements of the Comprehensive Plan, including: Policy L-1: Limit future urban development to currently developed lands within the urban service area. The boundary of the urban service area is otherwise known as the urban growth boundary. Retain undeveloped land west of Foothill Expressway and Junipero Serra as open space, with allowances made for very low-intensity development consistent with the open space character of the area. Retain undeveloped land northeast of Highway 101 as open space. Policy N-1.8. Minimize impacts of any new development on the character of public open space and the natural ecology of the hillsides. Policy N-1.9. All development in the foothill portion of the Planning Area (i.e., above Junipero Serra Boulevard) should visually blend in with its surroundings and minimize impacts to the natural environment. As such, development projects should: o Not be visually intrusive from public roadways and public parklands. o Be located away from hilltops. o Be clustered, or closely grouped, in relation to the area surrounding to reduce conspicuousness minimize access roads, and reduce fragmentation of natural habitats. o Include built forms and landscape forms that mimic the natural topography. o Retain existing vegetation as much as possible. o Utilize natural materials and earth tone or subdued colors. o Include landscaping composed of native species that require little or no irrigation. o Include exterior lighting that is low-intensity and shielded from view. o Include access roads of a rural rather than urban character. Policy L-7.15. Protect Palo Alto’s archaeological resources, including natural land formations, sacred sites, the historical landscape, historic habitats and remains of settlements here before the founding of Palo Alto in the 19th century. Views of the golf course are limited from adjacent streets. Certain rear yards of abutting residential properties have views of the project site. Trees are proposed to be planted to frame views and provide screening. Conditions of approval ensure that in the unlikely event of any archaeological resource discovery, protocols are in place. The renovation will use the latest design and construction techniques to reduce maintenance and improve sustainability. Grading would result in a net zero cut/fill amount. SECTION 4. Open Space Review Criteria The project proposal meets the following Open Space Review Criteria (italicized) and the intent of the Comprehensive Plan regarding development in designated open space areas. 1. The development should not be visually intrusive from public roadways and public parklands. As much as possible, development should be sited so it is hidden from view. There are limited views of the project site from the adjacent public roadways. Views from the adjacent natural preserve trails are also limited and taken from higher vantage points. Additional trees are proposed to be planted that will help the site further blend with its surroundings. 2. Development should be located away from hilltops and designed to not extend above the nearest ridgeline. The project does not extend to the nearest ridgeline. 3. Site and structure design should take into consideration impacts on privacy and views of neighboring properties. The views from the neighboring properties would be similar as they are today. Additional trees will be planted that may affect future views. 4. Development should be clustered, or closely grouped, in relation to the area surrounding it to make it less conspicuous, minimize access roads, and reduce fragmentation of natural habitats. The golf course will remain similar which changes to the fairways, greens and tees. A trash enclosure will be constructed adjacent to the clubhouse and flat work to expand a patio will be constructed adjacent to the clubhouse on the western side and not visible from the road or residences. 5. Built forms and landscape forms should mimic the natural topography. Building lines should follow the lines of the terrain, and trees and bushes should appear natural from a distance. The golf course is existing and the renovations will closely follow the topography as it is currently. The grading activities will result in a net zero cut and fill of soil. 6. Existing trees with a circumference of 37.5 inches, measured 4.5 feet above the ground level, should be preserved and integrated into the site design. Existing vegetation should be retained as much as possible. The Arborist Report and construction plans have been evaluated by the City’s Planning Arborist, who agreed sufficient tree protection measures are included in the project to ensure the retention of healthy, protected trees. Four protected trees are proposed for removal because of safety or health of the trees and 35 non-native trees will be removed and 132 redwood and oak trees are proposed for planting. 7. Cut is encouraged when it is necessary for geotechnical stability and to enable the development to blend into the natural topography. Fill is generally discouraged and should never be distributed within the driplines of existing trees. Locate development to minimize the need for grading. The project proposes grading that includes both cut and fill. There is zero net amount of cut and fill for the project. 8. To reduce the need for cut and fill and to reduce potential runoff, large, flat expanses of impervious surfaces should be avoided. Impervious areas are reduced from 6.5% to 6.25%. The project includes a renovation of a golf course that would improve the drainage onsite. 9. Buildings should use natural materials and earthtone or subdued colors. Natural building materials in earthtones are proposed. All proposed building materials are natural in appearance. 10. Landscaping should be native species that require little or no irrigation. Immediately adjacent to structures, fire retardant plants should be used as a fire prevention technique. The landscape plan was designed for lower maintenance. Native and drought tolerant plants were chosen, with the exception of the sod turf. 11. Exterior lighting should be low-intensity and shielded from view so it is not directly visible from off-site. No additional lighting is proposed for the project. 12. Access roads should be of a rural rather than urban character. (Standard curb, gutter, and concrete sidewalk are usually inconsistent with the foothills environment). The existing access way will be maintained. 13. For development in unincorporated areas, ground coverage should be in general conformance with Palo Alto's Open Space District regulations. The project is within the City limits and meets the O-S (Open Space) District zoning regulations. SECTION 5. Site and Design Approvals Granted. Site and Design Approval is granted by the City Council under Palo Alto Municipal Code Section 18.82.070 for application 19PLN-00304, subject to the conditions of approval in Section 6 of the Record. SECTION 6. Conditions of Approval. Planning Division 1) CONFORMANCE WITH PLANS. Construction and development shall conform to the approved plans entitled, "Palo Alto Hills Golf & Country Club” stamped as received by the City on January 23, 2020 on file with the Planning Department, 250 Hamilton Avenue, Palo Alto, California except as modified by these conditions of approval. 2) BUILDING PERMIT. Apply for a building permit and meet any and all conditions of the Planning, Fire, Public Works, and Building Departments. 3) BUILDING PERMIT PLAN SET. The Record of Land Use Action including all Department conditions of approval for the project shall be printed on the plans submitted for building permit. 4) PROJECT MODIFICATIONS: All modifications to the approved project shall be submitted for review and approval prior to construction. If during the Building Permit review and construction phase, the project is modified by the applicant, it is the responsibility of the applicant to contact the Planning Division/project planner directly to obtain approval of the project modification. It is the applicant’s responsibility to highlight any proposed changes to the project and to bring it to the project planner’s attention. 5) PROJECT EXPIRATION: The project approval shall be valid for through two years after the adoption date of the Record of Land Use Action. In the event a building permit(s), if applicable, is not secured for the project within the time limit specified above, the approval shall expire and be of no further force or effect. Application for extension of this entitlement may be made prior to the one year expiration. 6) PARKING LOT TREES: The project scope shall include removing and replacing three struggling Chinese Pistache trees and adding four Coast Live oaks, spaced out evenly, to the grassy knoll area between the parking lot and main club entrance. The locations of these trees are detailed in Attachment D of the City Council Staff Report dated August 3, 2020, and in Exhibit A of this approval. 7) ARCHAELOGICAL RESOURCES: Palo Alto is known to contain widely dispersed prehistoric sites with shell ridden components, including human burials and a variety of artifacts. Therefore, cessation of all grading and construction activities is required, if any archaeological or human remains are encountered. At that time, retention of a qualified archaeologist to address the find in the field, notification of the Santa Clara County Medical Examiner's office, and if native American remains are discovered, evaluation of the finds by a Native American descendent shall be required. The Native American descendent, appointed by the Native American Heritage Commission of the State of California, would provide implementation of additional mitigation measures. 8) NESTING BIRDS AND NEST AVOIDANCE: Construction of the project, shall be prohibited during the general avian nesting season (February 1 – August 31), if feasible. If nesting season avoidance is not feasible, the applicant shall retain a qualified biologist, as approved by the City of Palo Alto, to conduct a preconstruction nesting bird survey of adjacent street trees to determine the presence/absence, location, and activity status of any active nests. The extent of the survey buffer area surrounding the site shall be established by the qualified biologist to ensure that direct and indirect effects to nesting birds are avoided. To avoid the destruction of active nests and to protect the reproductive success of birds protected by the Migratory Bird Treaty Act (MBTA) and California Fish & Wildlife Code (CFWC), nesting bird surveys shall be performed not more than 14 days prior to scheduled vegetation clearance and structure demolition. In the event that active nests are discovered, a suitable buffer (typically a minimum buffer of 50 feet for passerines and a minimum buffer of 250 feet for raptors) shall be established around such active nests and no construction shall be allowed within the buffer areas until a qualified biologist has determined that the nest is no longer active (i.e., the nestlings have fledged and are no longer reliant on the nest). No ground disturbing activities shall occur within this buffer until the qualified biologist has confirmed that breeding/nesting is completed and the young have fledged the nest. Nesting bird surveys are not required for construction activities occurring between August 31 and February 1. 9) INDEMNITY: To the extent permitted by law, the Applicant shall indemnify and hold harmless the City, its City Council, its officers, employees and agents (the “indemnified parties”) from and against any claim, action, or proceeding brought by a third party against the indemnified parties and the applicant to attack, set aside or void, any permit or approval authorized hereby for the Project, including (without limitation) reimbursing the City for its actual attorneys’ fees and costs incurred in defense of the litigation. The City may, in its sole discretion, elect to defend any such action with attorneys of its own choice. 10) DEVELOPMENT IMPACT FEES: Estimated Development Impact Fees ($3,834,694.42) plus the applicable public art fee, per PAMC 16.61.040, shall be paid prior to the issuance of the related building permit. 11) IMPACT FEE 90-DAY PROTEST PERIOD. California Government Code Section 66020 provides that a project applicant who desires to protest the fees, dedications, reservations, or other exactions imposed on a development project must initiate the protest at the time the development project is approved or conditionally approved or within ninety (90) days after the date that fees, dedications, reservations or exactions are imposed on the Project. Additionally, procedural requirements for protesting these development fees, dedications, reservations and exactions are set forth in Government Code Section 66020. IF YOU FAIL TO INITIATE A PROTEST WITHIN THE 90-DAY PERIOD OR FOLLOW THE PROTEST PROCEDURES DESCRIBED IN GOVERNMENT CODE SECTION 66020, YOU WILL BE BARRED FROM CHALLENGING THE VALIDITY OR REASONABLENESS OF THE FEES, DEDICATIONS, RESERVATIONS, AND EXACTIONS. If these requirements constitute fees, taxes, assessments, dedications, reservations, or other exactions as specified in Government Code Sections 66020(a) or 66021, this is to provide notification that, as of the date of this notice, the 90-day period has begun in which you may protest these requirements. This matter is subject to the California Code of Civil Procedures (CCP) Section 1094.5; the time by which judicial review must be sought is governed by CCP Section 1094.6. 12) FINAL INSPECTION: A Planning Division Final inspection will be required to determine substantial compliance with the approved plans prior to the scheduling of a Building Division final. Any revisions during the building process must be approved by Planning, including but not limited to; materials, landscaping and hard surface locations. Contact your Project Planner, Sheldon S. Ah Sing at sahsing@m-group.us to schedule this inspection. Public Works Engineering 13) EASEMENT: City records indicate an existing Public Utilities Easement running through a portion of the site. Provide location and note the easement in plan set. Proposed items shall be placed outside of existing easement area. Refer to Utilities 14) DEMOLITION PLAN: Place the following note adjacent to an affected tree on the Site Plan and Demolition Plan: “Excavation activities associated with the proposed scope of work shall occur no closer than 10-feet from the existing street tree, or as approved by the Urban Forestry Division contact 650-496-5953. Any changes shall be approved by the same”. 15) GRADING PERMIT: Separate Excavation and Grading Permit will be required for grading activities on private property that fill, excavate, store or dispose of 100 cubic yards or more based on PAMC Section 16.28.060. Applicant shall prepare and submit an excavation and grading permit to Public Works separately from the building permit set. The permit application and instructions are available at the Development Center and on our website. http://www.cityofpaloalto.org/gov/depts/pwd/forms_and_permits.asp 16) GRADING & DRAINAGE PLAN: The plan set must include a grading & drainage plan prepared by a licensed professional that includes existing and proposed spot elevations, earthwork volumes, finished floor elevations, area drain and bubbler locations, drainage flow arrows to demonstrate proper drainage of the site. Adjacent grades must slope away from the house a minimum of 2% or 5% for 10-feet per 2013 CBC section 1804.3. Downspouts and splashblocks should be shown on this plan, as well as any site drainage features such as swales, area drains, bubblers, etc. Grading that increases drainage onto, or blocks existing drainage from neighboring properties, will not be allowed. Public Works generally does not allow rainwater to be collected and discharged into the street gutter, but encourages the developer to keep rainwater onsite as much as feasible by directing runoff to landscaped and other pervious areas of the site. See the Grading & Drainage Plan Guidelines for New Single Family Residences on the City’s website. http://www.cityofpaloalto.org/civicax/filebank/documents/2717 17) UTILITIES: Note that all above ground utilities, such as transformer, backflow preventer, gas meters, etc., shall be located within project site but accessible from the street. Any new or relocated utilities will correspond with approved locations from City Utilities Department. 18) TRASH ENCLOUSRE: Proposed trash enclosures shall drain to sanitary only. 19) EROSIONAL CONTROL: Plan set shall include a full erosional control plan outlining mitigation measures along with appropriate details for each component. 20) EXCAVATION: Provide deepest excavation depth on plan set (sections) with a note and dimension. 21) DEWATERING: Excavation may require dewatering during construction. Public Works only allows groundwater drawdown well dewatering. Open pit groundwater dewatering is not allowed. The geotechnical report for this site must list the highest anticipated groundwater level. We recommend that a piezometer be installed in the soil boring. The contractor shall determine the depth to groundwater immediately prior to excavation by using a piezometer or by drilling and exploratory hole. Based on the determined groundwater depth and season the contractor may be required to dewater the site or stop all grading and excavation work. In addition Public Works may require that all groundwater be tested for contaminants prior to initial discharge and at intervals during dewatering. If testing is required, the contractor must retain an independent testing firm to test the discharge water for contaminants Public Works specifies and submit the results to Public Works. 22) Public Works reviews and approves dewatering plans as part of a Grading Permit. The applicant can include a dewatering plan in the building permit plan set in order to obtain approval of the plan during the building permit review, but the contractor will still be required to obtain a Grading Permit prior to dewatering. Alternatively, the applicant must include the above dewatering requirements in a note on the site plan. Public Works has a sample dewatering plan sheet and dewatering guidelines available at the Development Center and on our website. http://www.cityofpaloalto.org/gov/depts/pwd/forms_and_permits.asp 23) WATER FILLING STATION: applicant shall install a water station for the non-potable reuse of the dewatering water. This water station shall be constructed within private property, next to the right- of-way, (typically, behind the sidewalk). The station shall be accessible 24 hours a day for the filling of water carrying vehicles (i.e. street sweepers, etc.). The water station may also be used for onsite dust control. Before a discharge permit can be issued, the water supply station shall be installed, ready for operational and inspected by Public Works. The groundwater will also need to be tested for contaminants and chemical properties for the non-potable use. The discharge permit cannot be issued until the test results are received. Additional information regarding the station will be made available on the City’s website under Public Works. 24) WORK IN THE RIGHT-OF-WAY: The plans must clearly indicate any work that is proposed in the public right-of-way, such as sidewalk replacement, driveway approach, or utility laterals. The plans must include notes that the work must be done per City standards and that the contractor performing this work must first obtain a Street Work Permit from Public Works at the Development Center. If a new driveway is in a different location than the existing driveway, then the sidewalk associated with the new driveway must be replaced with a thickened (6” thick instead of the standard 4” thick) section. Additionally, curb cuts and driveway approaches for abandoned driveways must be replaced with new curb, gutter and planter strip. 25) Provide the following note on the Site Plan and adjacent to the work within the Public road right-of- way. “Any construction within the city’s public road right-of-way shall have an approved Permit for Construction in the Public Street prior to commencement of this work. THE PERFORMANCE OF THIS WORK IS NOT AUTHORIZED BY THE BUILDING PERMIT ISSUANCE BUT SHOWN ON THE BUILDING PERMIT FOR INFORMATION ONLY.” 26) Provide the following note on the Site Plan and Grading and Drainage Plan: “Contractor shall not stage, store, or stockpile any material or equipment within the public road right-of-way.” Construction phasing shall be coordinate to keep materials and equipment onsite. 27) Any existing driveway to be abandoned shall be replaced with standard curb & gutter. This work must be included within a Permit for Construction in the Public Street from the Public Works Department. A note of this requirement shall be placed on the plans adjacent to the area on the Site Plan. 28) IMPERVIOUS SURFACE AREA: The project will be creating or replacing 500 square feet or more of impervious surface. Accordingly, the applicant shall provide calculations of the existing and proposed impervious surface areas with the building permit application. The Impervious Area Worksheet for Land Developments form and instructions are available at the Development Center or on our website. Include a hard copy in submittal. 29) PUBLIC WORKS STANDARDS CONDITIONS: The City's full-sized "Standard Conditions" sheet must be included in the plan set. Copies are available from Public Works on our website: http://www.cityofpaloalto.org/civicax/filebank/blobdload.aspx?t=67175.06&BlobID=66261 30) STORM WATER POLLUTION PREVENTION: The City's full-sized "Pollution Prevention - It's Part of the Plan" sheet must be included in the plan set. Copies are available from Public Works on our website http://www.cityofpaloalto.org/civicax/filebank/documents/2732 31) LOGISTICS PLAN: The contractor/designer must submit a logistics plan to the Public Works Department prior to commencing work that addresses all impacts to the City’s right-of-way, including, but not limited to: pedestrian control, traffic control, truck routes, material deliveries, contractor’s parking, concrete pours, crane lifts, work hours, noise control, dust control, storm water pollution prevention, contractor’s contact, noticing of affected businesses, and schedule of work. This plan shall be in the building set of plans. The plan will be attached to a street work permit. https://www.cityofpaloalto.org/civicax/filebank/blobdload.aspx?BlobID=2719 32) STORMWATER MAINTENANCE AGREEMENT: The applicant shall designate a party to maintain the control measures for the life of the improvements and must enter into a maintenance agreement with the City to guarantee the ongoing maintenance of the permanent C.3 storm water discharge compliance measures. The maintenance agreement shall be executed prior to building permit approval. The City will inspect the treatment measures yearly and charge an inspection fee. The plan check fee that will be collected upon submittal for a grading or building permit. Submit a hard copy of this item (document emailed alongside these comments). Urban Forestry 33) TREE PROTECTION COMPLIANCE. The owner and contractor shall implement all protection and inspection schedule measures, design recommendations and construction scheduling as stated in the TPR & Sheet T-1, and is subject to code compliance action pursuant to PAMC 8.10.080. The required protective fencing shall remain in place until final landscaping and inspection of the project. Project arborist approval must be obtained and documented in the monthly activity report sent to the City. The mandatory Contractor and Arborist Monthly Tree Activity Report shall be sent monthly to the City (pwps@cityofpaloalto.org) beginning with the initial verification approval, using the template in the Tree Technical Manual, Addendum 11. 34) PLAN CHANGES. Revisions and/or changes to plans before or during construction shall be reviewed and responded to by the (a) project site arborist, or (b) landscape architect with written letter of acceptance before submitting the revision to the Building Department for review by Planning, PW or Urban Forestry. 35) TREE DAMAGE. Tree Damage, Injury Mitigation and Inspections apply to Contractor. Reporting, injury mitigation measures and arborist inspection schedule (1-5) apply pursuant to TTM, Section 2.20- 2.30. Contractor shall be responsible for the repair or replacement of any publicly owned or protected trees that are damaged during the course of construction, pursuant to Title 8 of the Palo Alto Municipal Code, and city Tree Technical Manual, Section 2.25. 36) GENERAL. The following general tree preservation measures apply to all trees to be retained: No storage of material, topsoil, vehicles or equipment shall be permitted within the tree enclosure area. The ground under and around the tree canopy area shall not be altered. Trees to be retained shall be irrigated, aerated and maintained as necessary to ensure survival. 37) TREE PROTECTION VERIFICATION. Prior to any site work verification from the contractor that the required protective fencing is in place shall be submitted to the Urban Forestry Section. The fencing shall contain required warning sign and remain in place until final inspection of the project. 38) EXCAVATION RESTRICTIONS APPLY (TTM, Sec. 2.20 C & D). Any approved grading, digging or trenching beneath a tree canopy shall be performed using ‘air-spade’ method as a preference, with manual hand shovel as a backup. For utility trenching, including sewer line, roots exposed with diameter of 1.5 inches and greater shall remain intact and not be damaged. If directional boring method is used to tunnel beneath roots, then Table 2-1, Trenching and Tunneling Distance, shall be printed on the final plans to be implemented by Contractor. 39) PLAN SET REQUIREMENTS. The final Plans submitted for building permit shall include the following information and notes on relevant plan sheets: a) SHEET T-1, BUILDING PERMIT. The building permit plan set will include the City’s full-sized, Sheet T-1 (Tree Protection-it's Part of the Plan!), available on the Development Center website at http://www.cityofpaloalto.org/civicax/filebank/documents/31783. The Applicant shall complete and sign the Tree Disclosure Statement and recognize the Project Arborist Tree Activity Inspection Schedule. Monthly reporting to Urban Forestry/Contractor is mandatory. (Insp. #1: applies to all projects; with tree preservation report: Insp. #1-7 applies) b) The Tree Preservation Report (TPR). All sheets of the Applicant’s TPR approved by the City for full implementation by Contractor, shall be printed on numbered Sheet T-1 (T-2, T-3, etc) and added to the sheet index. c) Plans to show protective tree fencing. The Plan Set (esp. site, demolition, grading & drainage, foundation, irrigation, tree disposition, utility sheets, etc.) must delineate/show the correct configuration of Type I, Type II or Type III fencing around each Regulated Tree, using a bold dashed line enclosing the Tree Protection Zone (Standard Dwg. #605, Sheet T-1; City Tree Technical Manual, Section 6.35-Site Plans); or by using the Project Arborist’s unique diagram for each Tree Protection Zone enclosure. Waste Gas Water 40) The applicant shall submit a completed water-gas-wastewater service connection application - loadsheet per unit for City of Palo Alto Utilities. The applicant must provide all the information requested for utility service demands (water in fixture units/g.p.m., gas in b.t.u.p.h, and sewer in fixture units/g.p.d.). The applicant shall provide the new total loads 41) The applicant shall submit improvement plans for utility construction. The plans must show the size and location of all underground utilities within the development and the public right of way. 42) The applicant shall submit improvement plans for utility construction. The plans must show the size and location of all underground utilities within the development and the public right of way including meters, backflow preventers, fire service requirements, sewer mains, sewer cleanouts, sewer lift stations and any other required utilities. Plans for new wastewater lateral need to include new wastewater pipe profiles showing existing potentially conflicting utilities especially storm drain pipes electric and communication duct banks. Existing duct banks need to be daylighted by potholing to the bottom of the ductbank to verify cross section prior to plan approval and starting lateral installation. Plans for new storm drain mains and laterals need to include profiles showing existing potential conflicts with sewer, water and gas. 43) The applicant shall be responsible for upgrading the existing utility mains and/or services as necessary to handle anticipated peak loads. This responsibility includes all costs associated with the design and construction for the installation/upgrade of the utility mains and/or services. 44) The gas service, meters, and meter location must meet WGW standards and requirements 45) An approved reduced pressure principle assembly (RPPA backflow preventer device) is required for all existing and new water connections from Palo Alto Utilities to comply with requirements of California administrative code, title 17, sections 7583 through 7605 inclusive. The RPPA shall be installed on the owner's property and directly behind the water meter within 5 feet of the property line. RPPA’s for domestic service shall be lead free. Show the location of the RPPA on the plans. 46) An approved reduced pressure detector assembly is required for the new water connection for the fire system to comply with requirements of California administrative code, title 17, sections 7583 through 7605 inclusive. Reduced pressure detector assemblies shall be installed on the owner's property adjacent to the property line, within 5’ of the property line. Show the location of the reduced pressure detector assembly on the plans. 47) The applicant shall pay the capacity fees and connection fees associated with new utility service/s or added demand on existing services. The approved relocation of services, meters, hydrants, or other facilities will be performed at the cost of the person/entity requesting the relocation. 48) Each unit or place of business shall have its own water and gas meter shown on the plans. Each parcel shall have its own water service, gas service and sewer lateral connection shown on the plans. 49) All existing water and wastewater services that will not be reused shall be abandoned at the main per WGW utilities procedures. 50) Utility vaults, transformers, utility cabinets, concrete bases, or other structures cannot be placed over existing water, gas or wastewater mains/services. Maintain 1’ horizontal clear separation from the vault/cabinet/concrete base to existing utilities as found in the field. If there is a conflict with existing utilities, Cabinets/vaults/bases shall be relocated from the plan location as needed to meet field conditions. Trees may not be planted within 10 feet of existing water, gas or wastewater mains/services or meters. New water, gas or wastewater services/meters may not be installed within 10’ or existing trees. Maintain 10’ between new trees and new water, gas and wastewater services/mains/meters. 51) All utility installations shall be in accordance with the City of Palo Alto current utility standards for water, gas & wastewater. Fire 52) Improve/create driveway approach onto the golf course property from Alexis Drive near the existing water well by the 8th Hole (proposed 7th hole). Security gate/chain across the opening to prevent unauthorized vehicle entry is recommended. 53) Label golf course emergency vehicle access points with numbers/letters following the PAFD sign standard. 54) Install 2-1/2" wharf hydrants along the golf cart pathway where the greens parallel the wildland urban interface. The wharf hydrant water source can be connected to the golf course irrigation system. Contact Karl Schneider/Claire Shum w/ PAFD 650-329-2573 for preferred location of wharf hydrants. 55) Improve vertical clearance along golf cart pathways so fire apparatus can drive underneath and not impact landscaping/trees. 56) Paint fire hydrants/fire department connection at club house/fitness center. Clear landscaping around fire hydrants/fire department connections. Install blue roadway marker at fire hydrants near club house/fitness center. Watershed Protection 57) The applicant shall work with the Watershed Protection Group to outline O&M practices and frequencies onsite with respect to any fertilizers in the form of an agreement (or similar) prior to the issuance of a building permit for this work. This agreement shall be noted in the entitlement plan set and a draft agreement shall be included in the first submittal for the building plan set. 58) Stormwater treatment measures All Bay Area Municipal Regional Stormwater Permit requirements shall be followed. 59) Refer to the Santa Clara Valley Urban Runoff Pollution Prevention Program C.3 Handbook (download here: http://scvurppp-w2k.com/c3_handbook.shtml) for details. 60) For all C.3 features, vendor specifications regarding installation and maintenance should be followed and provided to city staff. Copies must be submitted to Pam Boyle Rodriguez at pamela.boylerodriguez@cityofpaloalto.org. Add this bullet as a note to the building plans. 61) Staff from Stormwater Program (Watershed Protection Division) may be present during installation of stormwater treatment measures. Contact Pam Boyle Rodriguez, Stormwater Program Manager, at (650) 329-2421 before installation. Add this bullet as a note to building plans on Stormwater Treatment (C.3) Plan. 62) Stormwater quality protection temporary and permanent waste, compost and recycling containers shall be covered to prohibit fly-away trash and having rainwater enter the containers. Building 63) Golf facilities shall comply with 11B-238, CBC. Amend plans to show and illustrate accessible compliance at all areas. Provide an accessible path plan by means of a dashed line to all public areas. If site infeasibility, please include explanation of operations as part of plans. 64) Retaining walls shall be designed by a civil/structural engineer. Submit the design at building permit. See LD-1 for retaining walls. Recycling 65) Applicant shall ensure that all internal and external containers include recycle (blue container), compost (green container), and garbage (black container). Each container shall be placed closely together, color coded, with proper signage. Single waste containers in common areas are prohibited for waste disposable. 66) Trash enclosure must be covered. 67) Collection vehicle access (vertical clearance, street width and turnaround space) and street parking are common issues pertaining to new developments. Adequate space must be provided for vehicle access. 68) Weight limit for all drivable areas to be accessed by the solid waste vehicles (roads, driveways, pads) must be rated to 60,000 lbs. This includes areas where permeable pavement is used. 69) Carts and bins must be able to roll without obstacles or curbs to reach service areas "no jumping curbs" 70) Containers must be within 25 feet of service area or charges will apply. 71) All service areas must have a clearance height of 20’ for bin service. 72) New enclosures should consider rubber bumpers to reduce wear-and-tear on walls. 73) Service must be provided for garbage, recycling, and compost 74) Project plans must show the placement of all three refuse containers, for example, within the details of the solid waste enclosures. Enclosure and access should be designed for equal access to all three waste streams – garbage, recycling, and compostables. Exhibit A Parking Lot Tree Planting & Replacement Map SECTION 7. Term of Approval. Site and Design Approval. In the event actual construction of the project is not commenced within two years of the date of council approval, the approval shall expire and be of no further force or effect, pursuant to Palo Alto Municipal Code Section 18.30(G).080. PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: APPROVED: _________________________ ____________________________ City Clerk Director of Planning & Development Services APPROVED AS TO FORM: ___________________________ Senior Asst. City Attorney PLANS AND DRAWINGS REFERENCED: 1. Those plans prepared by Costello – Hollinger - Moore entitled “Palo Alto Hills Golf & Country Club”, consisting of 47 pages, dated January 15, 2020, and received on January 23, 2020. ATTACHMENT C ZONING COMPARISON TABLE 3000 Alexis Drive 19PLN-00324 Table 1a: COMPARISON WITH CHAPTER 18.28 (OS DISTRICT) Regulation Required Existing Proposed Minimum Site Area, Width and Depth Area: 10 acres Width: No standard Depth: No standard Area: 128.58 acres Width: approx. 3,500 feet Depth: approx. 2,350 feet No change Front Yard 30 feet 280 feet to clubhouse No change Street Side Yard 30 feet N/A N/A Rear Yard 30 feet 1,448 feet to clubhouse No change Interior Side Yard 30 feet Clubhouse: 66 feet on left side 2,559 feet on right side No change Max. Building Height 25 feet average height of the highest gable 25 feet No change Maximum Impervious Coverage 3.5% of site (196,033 sf) 6.5% (364,507 sf)1 6.25% (350,298 sf) Max. Total Floor Area Ratio 5% (280,047 sf) for a 128.58 acre site 0.16% (86,903 sf) 0.16% (87,303 sf) 1 Approved as legal non-conforming in 2008. Table 1b: CONFORMANCE WITH CHAPTER 18.52 (Off-Street Parking and Loading) Recreation Type Required Existing Proposed Vehicle Parking One space per four person capacity = 302 spaces1 302 spaces No change 1 Approved with CUP in 2008. t 650+321+0202 | po box 971 los gatos ca 95031 | urbantreemanagement.com contractors license # 755989 l certified arborist WC ISA #623 l certified tree risk assessor #1399 urbantreemanagement inc. 5/26/2020 Palo Alto Hills Golf and Country Club 3000 Alexis Drive Palo Alto, CA 94304 Re: Parking lot trees To Whom It May Concern: Assignment It was our assignment to assess the overall health and viability of the trees located in and around the parking lot area. Summary Statement The overall health of the trees in the parking lot area is fair/good and the trees are stable with the exception of three of the Chinese pistache. We recommend removing and replacing 3 of the struggling Chinese pistache trees and adding 4 Coast live oaks, spaced out evenly, to the Grassy knoll area between the parking lot and main club entrance. Discussion All the trees in the parking lot area are well irrigated and receive regular maintenance. There are thirty-six Chinese pistache (Pistacia chinensis), seven Coast live oaks (Quercus agrifolia), four Cedar (Cedrus sp.), one Canary Island pine (Pinus canariensis), and one Monterey cypress (Cupressus macrocarpa) tree in and around the parking lot area. Three of the Chinese pistache 2 trees pictured below should be removed and replaced due to poor and fair/poor health and structure ratings. We recommend adding four Coast live oaks, spaced out evenly, to left and right of the water feature shown below. The Coast live oaks should be planted on the level area in the grassy knolls pictured below. 3 Images of the healthy Chinese pistache trees and the overall good health and vigor of the parking lot trees. Rating Health Structure Good excellent/vigorous flawless Fair/good no significant health concerns very stable Fair declining, measures should be taken to improve health and appearance. routine maintenance needed such as pruning or end weight reduction as tree grows Fair/poor in decline, significant health issues significant structural weakness(es), mitigation needed, mitigation may or may not preserve the tree Poor dead or near dead hazard 4 I certify that the information contained in this report is correct to the best of my knowledge and that this report was prepared in good faith. Please call me if you have questions or if I can be of further assistance. Respectfully, Michael P. Young Attachment E Project Plans Due to the current shelter-in-place, these plans are only available to the public online. Directions to review Project plans online: 1. Go to: bit.ly/PApendingprojects 2. Scroll to find “3000 Alexis Drive” and click the address link 3. On this project specific webpage you will find a link to the Project Plans and other important information Direct Link to Project Webpage: https://www.cityofpaloalto.org/news/displaynews.asp?NewsID=4818&TargetID=319 CITY OF PALO ALTO OFFICE OF THE CITY CLERK August 3, 2020 The Honorable City Council Palo Alto, California SECOND READING: Adoption of Amendments to the City of Palo Alto Tobacco Retailer Permit Ordinance (PAMC Chapter 4.64) to Further Restrict Electronic Cigarette Products and Flavored Tobacco Products (FIRST READING: June 16, 2020 PASSED: 4-3 DuBois, Fine, Kniss no) This was first heard by the City Council on June 16, 2020, where the following Motion and Substitute Motion were made. The Substitute Motion was passed 4-3 DuBois, Fine, Kniss no. It is now before the City Council for the second reading. MOTION: Council Member Kniss moved, seconded by Vice Mayor DuBois to Direct Staff to create an Ordinance with the following: A. A complete ban on vaping; B. To exempt adult-only stores to sell flavored tobacco products including cigar pipe, chewing, and paper cigarettes; and C. To exempt the onsite use of flavored tobacco products for currently permitted businesses. INCORPORATED INTO THE MOTION WITH THE CONSENT OF THE MAKER AND SECONDER to change Motion, Part A to read, “…complete ban on the sale of vaping products”. MOTION AS AMENDED RESTATED: Council Member Kniss moved, seconded by Vice Mayor DuBois to direct Staff to create an Ordinance with the following: A. A complete ban on the sale of vaping products; B. To exempt adult-only stores to sell flavored tobacco products including cigar, pipes, chewing, and paper cigarettes; and C. To exempt the onsite use of flavored tobacco products for currently permitted businesses. Page 2 SUBSTITUTE MOTION: Council Member Tanaka moved, seconded by Council Member Cormack to adopt amendments to the City of Palo Alto Tobacco Retailer Permit Ordinance (Palo Alto Municipal Code Chapter 4.64) to further restrict electronic cigarette products and flavored tobacco products. SUBSTITUTE MOTION PASSED: 4-3 DuBois, Fine, Kniss no ATTACHMENTS: • Attachment A: Tobacco Ordinance (PDF) Department Head: Beth Minor, City Clerk Page 3 *Not Yet Approved* 1 20200630_ts_24_206 Ordinance No. _____ Ordinance of the Council of the City of Palo Alto Amending Chapter 4.64 (Permits for Retailers of Tobacco Products) Of Title 4 (Business Licenses and Regulations). The Council of the City of Palo Alto ORDAINS as follows: SECTION 1. Findings and Declarations. The City Council finds and declares as follows: A. Electronic cigarettes, also known as e-cigarettes, e-vaporizers, or electronic nicotine delivery systems, are battery-operated devices that people use to inhale an aerosol that typically contains nicotine. In addition to nicotine, the aerosol from e-cigarettes may include up to 31 other components, including formaldehyde, acetaldehyde, glycidol, acrolein, acetol, and diacetyl. Several of these compounds are likely carcinogens, and acrolein is a powerful irritant.1 These products can resemble traditional tobacco cigarettes (cig-a-likes), cigars, or pipes, or even everyday items like pens or USB memory sticks.2 The pervasive use of these and other related Electronic Cigarette Products has given rise to a massive and multi-faceted public health crisis. B. The Surgeon General has declared the use of e-cigarettes among youth an “epidemic.” There is an extensive and rapidly growing body of evidence supporting that characterization. For instance: i. E-cigarette companies use marketing strategies to target youth. In 2014, 18 million (7 out of 10) middle and high school students were exposed to e- cigarette ads.3 ii. E-cigarettes are marketed in a variety of flavors that appeal to youth, including gummy bear, birthday cake, cotton candy, and fruit punch. iii. While youth use of combustible cigarettes has decreased dramatically, e- cigarette use—or “vaping”—among middle and high school students increased 1 Centers for Disease Control and Prevention. Cigarette Use Among Youth and Young Adults: A Report of the Surgeon General (2016). https://www.cdc.gov/tobacco/data_statistics/sgr/e-cigarettes/index.htm. 2 National Institute on Drug Abuse. Electronic Cigarettes (E-cigarettes) (2019). https://www.drugabuse.gov/publications/drugfacts/electronic-cigarettes-e-cigarettes; Breland A, Soule E, Lopez A, Ramôa C, El-Hellani A, Eissenberg T. Electronic cigarettes: what are they and what do they do? Ann N Y Acad Sci. 2017;1394(1):5-30. doi:10.1111/nyas.12977. 3 Centers for Disease Control and Prevention. E-cigarette Ads and Youth (2017). https://www.cdc.gov/vitalsigns/ecigarette-ads/index.html. *Not Yet Approved* 2 20200630_ts_24_206 by 78 percent between 2017 and 2018, with over 4 million kids currently using e- cigarettes in 2018.4 iv. The proportion of current e-cigarette users in high school who reported use on 20 days or more in the past 30-day period increased from 20 percent in 2017 to 27.7 percent in 2018.5 v. In 2019, the national prevalence of e-cigarette use during the previous 30 days was more than 1 in 4 students in the 12th grade, more than 1 in 5 in the 10th grade, and more than 1 in 11 in the 8th grade.6 vi. Use of e-cigarettes among undergraduate college students increased from 4.9 percent to 10.1 percent between 2017 and 2018.7 vii. There was a 46.2 percent increase in current e-cigarette use between 2017 and 2018 among young adults.8 viii. Adolescents obtain e-cigarettes from a variety of sources. The most common sources are: purchasing from a store or online (31.1 percent); buying from another person (16.3 percent); and giving someone money to purchase for them (15.0 percent).9 C. Nearly 1 in 3 Santa Clara County teens—31.6 percent—report that they have used an e- cigarette at least once. Most teens obtained their e-cigarettes from “social sources,” 4 Cullen KA, Ambrose BK, Gentzke AS, Apelberg BJ, Jamal A, King BA. Use of Electronic Cigarettes and Any Tobacco Product Among Middle and High School Students—United States, 2011–2018. MMWR Morb Mortal Wkly Rep. 2018;67(45):1276-1277. doi:10.15585/mmwr.mm6745a5. 5 Cullen KA, Ambrose BK, Gentzke AS, Apelberg BJ, Jamal A, King BA. Use of Electronic Cigarettes and Any Tobacco Product Among Middle and High School Students—United States, 2011–2018. MMWR Morb Mortal Wkly Rep. 2018;67(45):1276-1277. doi:10.15585/mmwr.mm6745a5. 6 Miech R, Johnston L, O’Malley PM, Bachman JG, Patrick ME. Trends in Adolescent Vaping, 2017–2019. N Engl J Med. September 2019:NEJMc1910739. doi:10.1056/NEJMc1910739. 7 Compare American College Health Association-National College Health Assessment II: Undergraduate Student Reference Group Executive Summary Spring 2018. Silver Spring, MD: American College Health Association with American College Health Association-National College Health Assessment II: Reference Group Undergraduate Executive Summary Spring 2017. Hanover, MD: American College Health Association. 8 Dai H, Leventhal AM. Prevalence of e-Cigarette Use Among Adults in the United States, 2014-2018. JAMA. September 2019. doi:10.1001/jama.2019.15331. 9 Pepper JK, Coats EM, Nonnemaker JM, Loomis BR. How Do Adolescents Get Their E-Cigarettes and Other Electronic Vaping Devices? Am J Health Promot. 2019;33(3):420-429. doi:10.1177/0890117118790366. *Not Yet Approved* 3 20200630_ts_24_206 while around 45 percent reported purchasing their own e-cigarettes (with over a quarter of this group saying they buy them directly from a local store).10 D. E-cigarettes have severe adverse health effects for both youth and adults. i. According to the Surgeon General, “[m]ost e-cigarettes contain nicotine—the addictive drug in regular cigarettes, cigars, and other tobacco products. Nicotine exposure during adolescence can harm the developing brain—which continues to develop until about age 25. Nicotine exposure during adolescence can impact learning, memory, and attention. Using nicotine in adolescence can also increase risk for future addiction to other drugs. In addition to nicotine, the aerosol that users inhale and exhale from e-cigarettes can potentially expose both themselves and bystanders to other harmful substances, including heavy metals, volatile organic compounds, and ultrafine particles that can be inhaled deeply into the lungs.”11 ii. E-cigarette use can also play a role in adolescent social maladjustment, including poor learning and academic performance, increased aggressive and impulsive behavior, poor sleep quality, attention deficits, impaired memory, cognition, and increased depression and suicidal ideation.12 iii. Daily e-cigarette use is associated with increased risk of irreversible cardiovascular and lung disease through the inhalation of harmful chemicals.13 iv. Secondhand emissions from e-cigarettes are also dangerous because they contain “nicotine; ultrafine particles; flavorings such as diacetyl, a chemical linked to serious lung disease; volatile organic compounds such as benzene, which is found in car exhaust; and heavy metals, such as nickel, tin, and lead.”14 10 Zhu S-H, Lee J, Zhuang YL, Branden K, Cole A, Wolfson T, Gamst A (2019). Tobacco use among high school students in Santa Clara County: Findings from the 2017-18 California Student Tobacco Survey. San Diego, California: Center for Research and Intervention in Tobacco Control (CRITC), University of California, San Diego. 11 Surgeon General’s Advisory on E-cigarette Use Among Youth (2008). https://e- cigarettes.surgeongeneral.gov/documents/surgeon-generals-advisory-on-e-cigarette-use-among-youth-2018.pdf. 12 Tobore TO. On the potential harmful effects of E-Cigarettes (EC) on the developing brain: The relationship between vaping-induced oxidative stress and adolescent/young adults social maladjustment. J Adolesc. 2019; 76:202-209. doi:10.1016/j.adolescence.2019.09.004. 13 American Lung Association. The Impact of E-Cigarettes on the Lung (2011). https://www.lung.org/stop- smoking/smoking-facts/impact-of-e-cigarettes-on-lung.html; Bein K, Leikauf GD. Acrolein - a pulmonary hazard. Mol Nutr Food Res 55(9):1342-60. doi: 10.1002/mnfr.201100279. 14 American Lung Association. The Impact of E-Cigarettes on the Lung (2011). https://www.lung.org/stop- smoking/smoking-facts/impact-of-e-cigarettes-on-lung.html. *Not Yet Approved* 4 20200630_ts_24_206 v. E-cigarette use is dangerous for pregnant women and is a fetal risk factor. It is associated with an increased risk of smallness-for-gestational-age.15 E. In addition to these negative long-term health effects, e-cigarette use is now associated with a wave of dangerous, life-threatening illnesses. i. As of October 15, 2019, 1,479 cases of acute lung injury associated with the use of e-cigarette or vaping products in 49 states, the District of Columbia, and 1 U.S. territory have been reported to the Centers for Disease Control and Prevention (CDC). Thirty-three deaths have been confirmed in 24 states.16 ii. Since the CDC’s August 30, 2019 Official Health Advisory,17 there have been two reported cases of lung injury associated with e-cigarettes in Santa Clara County. One of these cases was in an adolescent, and both individuals required hospitalization. F. Other risks and injuries are attributable to the proliferation of e-cigarettes: i. E-cigarettes present a poison risk for children. From 2013 to 2017, an estimated 4,745 e-liquid poisoning cases among children under age five were treated in U.S. hospital emergency departments.18 ii. E-cigarettes present a risk of burns and other injuries, usually from malfunctioning batteries. From 2015 to 2017, there were an estimated 2,035 e- cigarette explosion and burn injuries reported in U.S. hospital emergency rooms.19 // 15 Cardenas V, Cen R, Clemens M, et al. Use of Electronic Nicotine Delivery Systems (ENDS) by pregnant women I: Risk of small-for-gestational-age birth. Tob Induc Dis. 2019;17(May). doi:10.18332/tid/106089 16 Centers for Disease Control and Prevention. Outbreak of Lung Injury Associated with E-cigarette Use, or Vaping. October (2019). https://www.cdc.gov/tobacco/basic_information/e-cigarettes/severe-lung-disease.html. 17 Centers for Disease Control and Prevention Official Health Advisory. Severe Pulmonary Disease Associated with Using E-Cigarette Products (Aug. 30, 2019). https://emergency.cdc.gov/han/han00421.asp. 18 Chang JT, Wang B, Chang CM, Ambrose BK. National estimates of poisoning events related to liquid nicotine in young children treated in US hospital emergency departments, 2013–2017. Inj Epidemiol. 2019;6(1):10. doi:10.1186/s40621-019-0188-9. 19 Rossheim ME, Livingston MD, Soule EK, Zeraye HA, Thombs DL. Electronic cigarette explosion and burn injuries, US Emergency Departments 2015-2017. Tob Control. 2019;28(4):472-474. doi:10.1136/tobaccocontrol-2018- 054518. *Not Yet Approved* 5 20200630_ts_24_206 G. While the e-cigarette industry claims that its products help people quit smoking combustible cigarettes, the evidence shows that e-cigarette use is actually associated with increased risk of cigarette initiation, particularly among low-risk youths.20 i. Use of e-cigarettes was most common among smokers, and dual users had the highest prevalence of respiratory symptoms. On a population level, this indicates that the present use of e-cigarettes does not adequately serve as a smoking cessation tool.21 ii. E-cigarettes are not commonly used as a quit tool among college students, but rather as a secondary source of nicotine, most commonly in current smokers.22 iii. Of adults and young adults over 18 who use e-cigarettes, around 63 percent typically use non-tobacco flavored e-cigarettes, while over a third typically use tobacco-flavored or unflavored e-cigarettes.23 H. Open e-cigarette systems are customizable by consumers and often allow for potential “unorthodox” use of the product. These modifications include altering mechanical components and replacing liquid cartridges with dangerous off-market or illegal substances.24 Customization is one of the most popular social media topics for e- cigarettes.25 // // 20 Berry KM, Fetterman JL, Benjamin EJ, et al. Association of Electronic Cigarette Use With Subsequent Initiation of Tobacco Cigarettes in US Youths. JAMA Netw Open. Published online February 01, 2019;2(2):e187794. doi:10.1001/jamanetworkopen.2018.7794. 21 Hedman L, Backman H, Stridsman C, et al. Association of Electronic Cigarette Use With Smoking Habits, Demographic Factors, and Respiratory Symptoms. JAMA Netw Open. 2018;1(3):e180789. doi:10.1001/jamanetworkopen.2018.0789. 22 Martinasek MP, Bowersock A, Wheldon CW. Patterns, Perception and Behavior of Electronic Nicotine Delivery Systems Use and Multiple Product Use Among Young Adults. Respir Care. 2018;63(7):913-919. doi:10.4187/respcare.06001. 23 Landry RL, Groom AL, Vu T-HT, et al. The role of flavors in vaping initiation and satisfaction among U.S. adults. Addict Behav. 2019;99:106077. doi:10.1016/j.addbeh.2019.106077. 24 Guy MC, Helt J, Palafox S, et al. Orthodox and Unorthodox Uses of Electronic Cigarettes: A Surveillance of YouTube Video Content. Nicotine Tob Res. 2019;21(10):1378-1384. doi:10.1093/ntr/nty132. 25 Lee A, Hart J, Sears C, Walker K, Siu A, Smith C. A picture is worth a thousand words: Electronic cigarette content on Instagram and Pinterest. Tob Prev Cessat. 2017;3(July). doi:10.18332/tpc/74709. *Not Yet Approved* 6 20200630_ts_24_206 SECTION 2. Chapter 4.64 (Permits for Retailers of Tobacco Products) of Title 4 (Business Licenses and Regulations) is hereby amended and restated as follows: CHAPTER 4.64. PERMITS FOR RETAILERS OF TOBACCO PRODUCTS 4.64.010. Intent. This Chapter is adopted to: (1) Ensure compliance with the business standards and practices of the County; (2) Encourage responsible retailing of Tobacco Products; (3) Discourage violations of laws related to Tobacco Products, especially those that prohibit or discourage the Sale or Distribution of Tobacco Products to individuals under 21; (4) Respond to a new wave of addiction to Electronic Cigarette Products; (5) Reduce vulnerability to unexplained illnesses associated with Electronic Cigarette Products; and (6) Protect the public health and welfare. This Chapter does not expand or reduce the degree to which the acts regulated by federal or state law are criminally proscribed or alter the penalties provided by such laws. 4.64.020. Definitions. For the purposes of this Chapter, the following definitions shall apply: (a) Arm’s Length Transaction means a Sale in good faith and for valuable consideration that reflects the fair market value in the open market between two or more informed and willing parties, neither of which is under any compulsion to participate in the transaction. A Sale between relatives, related companies or partners, or a Sale for which a significant purpose is avoiding the effect of the violations of this Chapter is not an Arm’s Length Transaction. (b) Department means any department of the City of Palo Alto or County of Santa Clara designated by the City Manager to enforce or administer this Chapter, including the County of Santa Clara’s Department of Environmental Health and any agency or Person designated by the Director of the Department of Environmental Health to enforce or administer the provisions of this Chapter. *Not Yet Approved* 7 20200630_ts_24_206 (c) Distribute or Distribution means the transfer, by any Person other than a common carrier, of a Tobacco Product to another Person for Sale or personal consumption. (d) Electronic Cigarette Products means any of the following products: (1) Any device or delivery system that can be used to deliver nicotine in aerosolized or vaporized form, including, but not limited to, an e-cigarette, e-cigar, e-pipe, vape pen, or e-hookah. (2) Any component, part, or accessory of such a device or delivery system that is used during its operation. (3) Any flavored or unflavored liquid or substance containing nicotine, whether Sold separately or Sold in combination with any device or delivery system that could be used to deliver nicotine in aerosolized or vaporized form. (4) Any product for use in an electronic nicotine device or delivery system whether or not it contains nicotine or tobacco or is derived from nicotine or tobacco. (5) Electronic Cigarette Products shall not include any battery, battery charger, carrying case, or other accessory not used in the operation of the device if Sold separately. Electronic Cigarette Products shall not include any product that has been approved by the United States Food and Drug Administration for Sale as a tobacco cessation product or for other therapeutic purposes where that product is marketed and Sold solely for such approved use. See 21 U.S.C. § 387(a). As used in this subsection, nicotine does not include any food products as that term is defined pursuant to Section 6359 of the California Revenue and Taxation Code. (e) Ownership means possession of a ten percent or greater interest in the stock, assets, or income of a business, other than a security interest for the repayment of debt. Notwithstanding any other definition in this Code, an Owner means a Person who possesses Ownership. (f) Permit means a valid permit issued by the Department to a Person to act as a Retailer. (g) Retailer means any Person who Sells or Distributes Tobacco Products for any form of consideration. Retailing shall mean the doing of any of these actions. This definition is without regard to the quantity of Tobacco Products Sold or Distributed. (h) School means a public or private elementary, middle, junior high, or high school. (i) Sale and Sold includes any sale, exchange, barter or offer for sale. *Not Yet Approved* 8 20200630_ts_24_206 (j) Tobacco Product means (unless specifically noted elsewhere) any product subject to Subchapter IX (21 U.S.C. § 387 et seq. (“Subchapter IX”)) of the Federal Food, Drug, and Cosmetic Act. (See 21 U.S.C. § 387a(b) (products subject to Subchapter IX); 21 C.F.R. §§ 1100.1-1100.3 (tobacco products subject to Subchapter IX).) Products subject to Subchapter IX include, but are not limited to, cigarettes, cigarette tobacco, roll-your- own tobacco, smokeless tobacco, cigars, pipe tobacco, waterpipe tobacco, and Electronic Cigarette Products. Products that are not subject to Subchapter IX include accessories of Tobacco Products, such as, but not limited to, ashtrays, spittoons, and conventional matches and lighters that solely provide an external heat source to initiate but not maintain combustion of a Tobacco Product. 4.64.030. Requirements and prohibitions. (a) Permit required. It shall be unlawful for any Person to act as a Retailer without first obtaining and maintaining a Permit pursuant to this Chapter for each location at which Retailing occurs. (b) Lawful business operation. It shall be a violation of this Chapter for any Retailer to violate any local, state, or federal law applicable to Tobacco Products or the Retailing of such Tobacco Products. (c) Display of Permit. Each Permit shall be prominently displayed in a publicly visible place at the location identified in the Permit. (d) Notice of minimum age for purchase of Tobacco Products. Retailers shall post conspicuously, at each point of purchase, a notice stating that selling Tobacco Products to anyone under 21 years of age is illegal and subject to penalties. Such notice shall be subject to the approval of the Public Health Department. (e) Positive identification required. No Retailer shall Sell or Distribute a Tobacco Product to another individual who appears to be under 30 years of age without first examining the individual’s identification to confirm that the individual is at least the minimum age required under state law to purchase and possess the Tobacco Product. (f) Minimum age for individuals selling Tobacco Products. No individual who is younger than the minimum age established by State law for the purchase or possession of Tobacco Products shall engage in Retailing. (g) False and misleading advertising prohibited. A Retailer without a Permit: (1) Shall keep all Tobacco Products out of public view. (2) Shall not display any advertisement relating to Tobacco Products that promotes the Sale or Distribution of such products from the Retailer’s location or that *Not Yet Approved* 9 20200630_ts_24_206 could lead a reasonable consumer to believe that Tobacco Products can be obtained at that location. (h) Limitation on storefront advertising. No more than 15 percent of the square footage of the windows and clear doors of a physical storefront used for Retailing Tobacco Products shall bear advertising or signs of any sort, and all advertising and signage shall be placed and maintained in a manner that ensures that law enforcement personnel have a clear and unobstructed view of the interior of the premises, including the area in which the cash registers are maintained, from the exterior public sidewalk or entrance to the premises. However, this latter requirement of this subsection (h) shall not apply to an establishment where there are no windows or clear doors, or where existing windows are located only at a height that precludes a view of the interior of the premises by an individual standing outside the premises. (i) Flavored Tobacco Products. (1) Except as permitted in paragraph (3) of this subsection (i), no Retailer shall Sell a Tobacco Product containing, as a constituent or additive, an artificial or natural flavor or aroma (other than tobacco) or an herb or spice, including but not limited to strawberry, grape, orange, clove, cinnamon, pineapple, vanilla, coconut, licorice, cocoa, chocolate, cherry, mint, menthol, or coffee, that is a characterizing flavor or aroma of the Tobacco Product, smoke, or vapor produced by the Tobacco Product. (2) A Tobacco Product shall be subject to a rebuttable presumption that the product is prohibited by paragraph (1) of this subsection if: (i) The product’s manufacturer or any other Person associated with the manufacture or Sale of Tobacco Products makes or disseminates public statements or claims to the effect that the product has or produces a characterizing flavor or aroma, other than tobacco; or (ii) The product’s label, labeling, or packaging includes a statement or claim—including any text and/or images used to communicate information—that the product has or produces a characterizing flavor or aroma, other than tobacco. (3) Except as provided in Paragraph (4) of this subsection (i), Paragraph (1) of this subsection (i) shall not apply to any Retailer that meets all the following criteria: (i) Primarily sells Tobacco Products; (ii) Generates more than 60 percent of its gross revenues annually from the Sale of Tobacco Products; *Not Yet Approved* 10 20200630_ts_24_206 (iii) Does not permit any individual under 21 years of age to be present or enter the premises at any time, unless accompanied by the individual’s parent or legal guardian, as defined in Section 6903 of the Family Code; (iv) Does not Sell alcoholic beverages or food for consumption on the premises; and (v) Posts a sign outside the retail location that clearly, sufficiently, and conspicuously informs the public that individuals under 21 years of age are prohibited from entering the premises. (4) No Retailer that is issued a new Permit after September 2, 2020 shall Sell or Distribute flavored Tobacco Products under paragraph (3) of this subsection (i) after Permit issuance. No Retailer that receives a Permit renewal after September 2, 2020 shall Sell or Distribute flavored Tobacco Products under paragraph (3) of this subsection (i) after Permit renewal. Regardless of the date of Permit issuance or renewal, no Retailer shall Sell or Distribute flavored Tobacco Products after September 2, 2020. (j) Vending machines prohibited. No Tobacco Product shall be Sold or Distributed to the public from a vending machine or appliance, or any other coin or token operated mechanical device designed or used for vending purposes, including, but not limited to, machines or devices that use remote control locking mechanisms. (k) Prohibition on Sale or Distribution of Tobacco Products to individuals under 21. No Retailer shall Sell or Distribute any Tobacco Product to any individual who is under 21 years of age. (l) Prohibition on Sale or Distribution of Electronic Cigarette Products. No Retailer that is issued a new Permit after September 2, 2020 shall Sell or Distribute Electronic Cigarette Products after Permit issuance. No Retailer that receives a Permit renewal after September 2, 2020 shall Sell or Distribute Electronic Cigarette Products after Permit renewal. Regardless of the date of Permit issuance or renewal, no Retailer shall Sell or Distribute Electronic Cigarette Products after September 2, 2020. 4.64.040. Eligibility requirements for a Permit. (a) No Permit may be issued to authorize Retailing at or from other than a fixed location. For example, Retailing by Persons on foot or from vehicles is prohibited. (b) No Permit may be issued to authorize Retailing at a temporary or recurring temporary event. For example, Retailing at flea markets and farmers’ markets is prohibited. *Not Yet Approved* 11 20200630_ts_24_206 (c) No Permit may be issued to authorize Retailing at any location where the profession of pharmacy is practiced by a pharmacist licensed by the State in accordance with the Business and Professions Code and where prescription drugs are offered for Sale. (d) No Permit may be issued to authorize Retailing at any location within 1,000 feet of a School, as measured by a straight line between any point along the property line of any parcel on which a School is located and any point along the perimeter of the Permit applicant’s proposed business location; provided, however, that the prohibition contained in this subsection (d) shall not apply to the following: (1) Any Retailer of Tobacco Products (as such term was defined in the predecessor Ordinance No. 5418) operating lawfully on June 30, 2018 provided that the Retailer obtains a permit prior to July 1, 2020 pursuant to sections 4.64.050 and 4.64.060, and timely renews its permit pursuant to section 4.64.070(b); (2) Any Retailer of electronic smoking devices (as such term was defined in the predecessor Ordinance No. 5418) operating lawfully on June 30, 2018 provided that the Retailer obtains a permit prior to July 1, 2020 pursuant to sections 4.64.050 and 4.64.060, and timely renews its permit pursuant to section 4.64.070(b); however, any such Retailer is subject to the prohibition on the Sale and Distribution of Electronic Cigarette Products established in Section 4.64.030(l); and (3) Any lawfully operating Retailer of Tobacco Products that would otherwise become ineligible to receive or renew a Permit due to the creation or relocation of a School. (e) No Permit may be issued to authorize Retailing at a location which is within 500 feet of a location occupied by another Retailer, as measured by a straight line between any point along the perimeter of an existing Retailer’s business location and any point along the perimeter of the Permit applicant’s proposed business location; provided, however, that the prohibition contained in this subsection (e) shall not apply to: (1) Any Retailer of Tobacco Products (as such term was defined in the predecessor Ordinance No. 5418) operating lawfully on June 30, 2018 provided that the Retailer obtains a permit prior to July 1, 2020 pursuant to sections 4.64.050 and 4.64.060, and timely renews its permit pursuant to section 4.64.070(b); and (2) Any Retailer of electronic smoking devices (as such term was defined in the predecessor Ordinance No. 5418) operating lawfully on June 30, 2018 provided that the Retailer obtains a permit prior to July 1, 2020 pursuant to sections 4.64.050 and 4.64.060, and timely renews its permit pursuant to section 4.64.070(b); however, any such Retailer is subject to the prohibition on the Sale *Not Yet Approved* 12 20200630_ts_24_206 and Distribution of Electronic Cigarette Products established in Section 4.64.030(l). (f) Any exemption granted to a Retailer pursuant to subsections (d) and (e) shall cease to apply upon the earlier of the following to occur: (1) The Retailer fails to timely renew the Permit pursuant to Section 4.64.070(b) of this Chapter. (2) A new Person obtains Ownership in the business. 4.64.050. Application procedure. (a) It is the responsibility of each Retailer to be informed of all laws applicable to Retailing, including those laws affecting the issuance of a Permit. No Retailer may rely on the issuance of a Permit as a determination by the City or County of Santa Clara that the Retailer has complied with all laws applicable to Retailing. A Permit issued contrary to this Chapter, contrary to any other law, or on the basis of false or misleading information supplied by a Retailer shall be revoked pursuant to Section 4.64.060 of this Chapter. (b) All Permit applications shall be submitted on a form supplied by the Department. (c) A permitted Retailer shall inform the Department in writing of any change in the information submitted on an application for a Permit within 14 calendar days of a change. (d) All information specified in an application pursuant to this section shall be subject to disclosure under the California Public Records Act (Government Code Section 6250 et seq.) or any other applicable law, subject to the laws’ exemptions. 4.64.060. Permit issuance, denial, and revocation. (a) Upon the receipt of a complete application for a Permit, the application fee, and the annual Permit fee, the Department shall issue a Permit unless substantial evidence demonstrates that one or more of the following bases for denial exists: (1) The information presented in the application is inaccurate or false. (2) The application seeks authorization for Retailing at a location for which this Chapter prohibits issuance of a Permit. (3) The application seeks authorization for Retailing by a Person to whom this Chapter prohibits issuance of a Permit. *Not Yet Approved* 13 20200630_ts_24_206 (4) The application seeks authorization for Retailing that is prohibited pursuant to this Chapter (e.g., mobile vending, Electronic Cigarette Products) or that is unlawful pursuant to any other law. (b) A Permit shall be revoked if the Department finds that one or more of the bases for denial of a Permit under this section existed at the time application was made or at any time before the Permit issued. Such a revocation shall be without prejudice to the filing of a new Permit application. 4.64.070. Permit term, renewal, and expiration. (a) Term of Permit. The term of a Permit is one year. A Permit is invalid upon expiration. (b) Renewal of Permit. The Department shall renew a Permit upon timely payment of the annual Permit fee provided that the Retailer is in compliance with this Chapter, as amended. The Department may, in its discretion, agree to renew any expired Permit within the three-month period following expiration if the Retailer pays the annual Permit fee and applicable late charges. For every calendar month, or fraction thereof, that a Retailer fails to renew an expired Permit, a late charge equal to 20 percent of the annual Permit fee shall be assessed. A Permit renewed within three calendar months of expiration shall be treated as if timely renewed. (c) Issuance of Permit after revocation or expiration of Permit. To apply for a new Permit more than three calendar months after expiration of a Permit or following revocation of a Permit that was wrongly issued, a Retailer must submit a complete application for a Permit, along with the application fee and annual Permit fee. The Department shall issue a Permit pursuant to the requirements of Section 4.64.060 of this Chapter. 4.64.080. Permits nontransferable. (a) A Permit may not be transferred from one Person to another or from one location to another. Whenever a new Person obtains Ownership in a business for which a Permit has been issued, a new Permit shall be required, but any exemption granted pursuant to Section 4.64.040 of this Chapter shall cease to apply. (b) Notwithstanding any other provision of this Chapter, prior violations of this Chapter at a location shall continue to be counted against a location and Permit ineligibility and suspension periods shall continue to apply to a location unless: (1) One hundred percent of the interest in the stock, assets, or income of the business, other than a security interest for the repayment of debt, has been transferred to one or more new owners; and *Not Yet Approved* 14 20200630_ts_24_206 (2) The City is provided with clear and convincing evidence, including an affidavit, that the business has been acquired in an Arm’s Length Transaction. 4.64.090. Permit conveys a limited, conditional privilege. Nothing in this Chapter shall be construed to grant any Person obtaining and maintaining a Permit any status or right other than the limited, conditional privilege to act as a Retailer at the location in the City identified on the face of the Permit. All Permits are issued subject to the City’s right to amend this Chapter, and Retailers shall comply with all provisions of this Chapter, as amended. 4.64.100. Fees. The Department shall not issue or renew a Permit prior to full payment of any applicable fees. The City shall, from time to time, establish by resolution or ordinance the fees to issue or to renew a Permit. The fees shall be calculated so as to recover the cost of administration and enforcement of this Chapter, including, for example, issuing a Permit, administering the Permit program, Retailer education, Retailer inspection and compliance checks, documentation of violations, and prosecution of violators, but shall not exceed the cost of the regulatory program authorized by this Chapter. All fees and interest earned from such fees shall be used exclusively to fund administration and enforcement of this Chapter. 4.64.110. Compliance monitoring. (a) Compliance with this Chapter shall be monitored by the Department. In addition, any peace officer may enforce the penal provisions of this Chapter. The City Manager may designate any number of additional individuals to monitor and facilitate compliance with this Chapter. (b) The Department or other individuals designated to enforce the provisions of this Chapter shall check each Retailer at least once per 12-month period to determine if the Retailer is complying with all laws applicable to Retailing, other than those laws regulating underage access to Tobacco Products. Nothing in this paragraph shall create a right of action in any Retailer or other Person against the City, the County of Santa Clara, or its agents. 4.64.120. Prevention of underage Sales. (a) The Department or other departments or individuals designated to enforce the provisions of this Chapter shall, in conjunction with the Police Department, check each Retailer at least twice per 12-month period to determine whether the Retailer is conducting business in a manner that complies with laws regulating youth access to Tobacco Products. Nothing in this paragraph shall create a right of action in any Retailer or other Person against the City, the County of Santa Clara, or its agents. *Not Yet Approved* 15 20200630_ts_24_206 (b) The City shall not enforce any law establishing a minimum age for Tobacco Product purchases against an individual who otherwise might be in violation of such law because of the individual’s age (“Youth Decoy”) if the potential violation occurs when: (1) The Youth Decoy is participating in a compliance check supervised by a peace officer or a code enforcement official of the City or County of Santa Clara; (2) The Youth Decoy is acting as an agent of a Department or individual designated by the City or County of Santa Clara to monitor compliance with this Chapter; or (3) The Youth Decoy is participating in a compliance check funded in part, either directly or indirectly through subcontracting, by the City, the County of Santa Clara, or the California Department of Public Health. 4.64.130. Penalties for a violation by a Retailer with a Permit. (a) Administrative fine. In addition to any other penalty authorized by law, an administrative fine shall be imposed and a Permit shall be suspended if any court of competent jurisdiction determines, or the Department finds based on a preponderance of the evidence that the Retailer, or any of the Retailer’s agents or employees, has violated any of the requirements, conditions, or prohibitions of this Chapter, has pled guilty, “no contest” or its equivalent to such a violation, or has admitted to a such a violation. (b) Amount of fine. The amount of the administrative fine for each such violation shall be as follows: (1) A fine not to exceed $100.00 for a first violation within a 12-month period; (2) A fine not to exceed $200.00 for a second violation within a 12-month period; and (3) A fine not to exceed $500.00 for each additional violation within a 12-month period. (c) Time period for Permit suspension. The period of the suspension shall be as follows: (1) For a first violation of this Chapter at a location within any 60-month period, the Permit shall be suspended for up to 30 calendar days. (2) For a second violation of this Chapter at a location within any 60-month period, the Permit shall be suspended for up to 90 calendar days. *Not Yet Approved* 16 20200630_ts_24_206 (3) For each additional violation of this Chapter at a location within any 60-month period, the Permit shall be suspended for up to one year. (d) Waiver of penalties for first violation. The Department may waive any penalties for a Retailer’s first violation of any requirement, condition, or prohibition of this Chapter, other than a violation of a law regulating youth access to Tobacco Products, if the Retailer admits the violation in writing and agrees to forego a hearing on the allegations. Regardless of the Department’s waiver of penalties for a first violation, the violation will be considered in determining the penalties for any future violation. (e) Corrections period. The Department shall have discretion to allow a Retailer a period of time to correct any violation of any requirement, condition, or prohibition of this Chapter, other than a violation of a law regulating youth access to Tobacco Products. If the Department exercises its discretion to provide a corrections period, and a Retailer’s violation is corrected within the time allowed for correction, no penalty shall be imposed under this section. (f) Written notice of penalties. Whenever a fine is issued and/or a Permit is suspended based on a violation of this Chapter, the Department shall provide the Retailer written notice of the violation and the fine and suspension, including when the suspension shall take effect. 4.64.140. Penalties for Retailing without a Permit. (a) Administrative fine. In addition to any other penalty authorized by law, an administrative fine and an ineligibility period for application or issuance of a Permit shall be imposed if a court of competent jurisdiction determines, or the Department finds based on a preponderance of evidence, that any Person has engaged in Retailing at a location without a valid Permit, either directly or through the Person’s agents or employees, has pled guilty, “no contest” or its equivalent to such a violation, or has admitted to such a violation. (b) Amount of fine. The amount of the administrative fine for each such violation shall be as follows: (1) A fine not to exceed $100.00 for a first violation within a 12-month period; (2) A fine not to exceed $200.00 for a second violation within a 12-month period; and (3) A fine not to exceed $500.00 for each additional violation within a 12-month period. // *Not Yet Approved* 17 20200630_ts_24_206 (c) Time period for Permit ineligibility. The ineligibility period shall be as follows: (1) For a first violation of this section at a location within any 60-month period, no new Permit may be issued for the Person or the location (unless Ownership of the business at the location has been transferred in an Arm’s Length Transaction) until 30 calendar days have passed from the date of the violation. (2) For a second violation of this section at a location within any 60-month period, no new Permit may be issued for the Person or the location (unless Ownership of the business at the location has been transferred in an Arm’s Length Transaction) until 90 calendar days have passed from the date of the violation. (3) For each additional violation of this section at a location within any 60-month period, no new Permit may be issued for the Person or the location (unless Ownership of the business at the location has been transferred in an Arm’s Length Transaction) until one year has passed from the date of the violation. (d) Waiver of penalties for first violation. The Department may waive any penalties for a Retailer’s first violation of this section, unless the violation also involves a violation of a law regulating youth access to Tobacco Products, if the Retailer admits the violation in writing and agrees to forego a hearing on the allegations. Regardless of the Department’s waiver of penalties for a first violation, the violation will be considered in determining the penalties for any future violation. (e) Written notice of penalties. Whenever a fine is issued and/or a Permit is suspended pursuant to this section, the Department shall provide the Retailer written notice of the fine and suspension, including when the suspension shall take effect. (f) Appeals. Any penalties imposed under this section may be appealed pursuant to Section 4.64.150 of this Chapter. A timely appeal shall stay enforcement of the appealed penalties while the appeal is ongoing. 4.64.150. Appeals. (a) Any Retailer served with a written notice of penalties may request an administrative hearing to appeal the existence of the violation, the amount of the fine, and/or the length of the suspension by returning a completed hearing request form to the Office of the County Hearing Officer within 10 days from the date of the written notice of penalties. (b) The Retailer shall include the following in or with the hearing request form: (1) A statement indicating the reason the Retailer contests the written notice of penalties; *Not Yet Approved* 18 20200630_ts_24_206 (2) Any evidence the Retailer wants the Hearing Officer to consider; (3) An advance deposit of the amount of any fine challenged; and (4) The address of the Retailer and, if available, an email address that can be used for contact and correspondence by the Office of the County Hearing Officer and the Department. The Retailer may request service of notice by mail. (c) The hearing request form shall be deemed filed on the date received by the Office of the County Hearing Officer. A timely appeal shall stay enforcement of the appealed penalties while the appeal is ongoing. (d) After receiving a timely hearing request form, the Office of the County Hearing Officer shall notify the Department as soon as practicable and then shall schedule an administrative hearing. The Office of the County Hearing Officer shall provide the Retailer and the Department at least ten calendar days’ written notice of the date, time, and place of the administrative hearing and the name of the Hearing Officer who will conduct the hearing. The notice shall be given to the Retailer either by email, if requested, or by first class mail, postage prepaid. (e) Between the time the Retailer requests the administrative hearing and the time of the Hearing Officer’s decision, the Retailer, the Department, and each of their representatives shall not engage in ex parte communications with the Office of the County Hearing Officer or the Hearing Officer regarding the matters at issue in the hearing. (f) The hearing shall be conducted by the Hearing Officer on the date, time, and place specified in the notice to the Retailer. A Retailer’s failure to appear at the hearing shall constitute an abandonment of the hearing request and a failure to exhaust administrative remedies as a precedent to judicially challenge the existence of the violation and the imposition of the fine and suspension. (g) At the hearing, the Retailer and the Department shall have the opportunity to present evidence, including witnesses, relevant to the Hearing Officer’s determination of the matter. Neither the provisions of the Administrative Procedure Act (Government Code Section 11500 et seq.) nor the formal rules of evidence in civil or criminal judicial proceedings shall apply to such hearing. The Hearing Officer may admit any evidence, including witnesses, relevant to the determination of the matter, except as otherwise provided in Section 4.64.160(c). (h) The written notice of penalties and any other reports prepared by or for the Department concerning the violation shall be admissible and accepted by the Hearing Officer as prima facie evidence of the violation and the facts stated in those documents. *Not Yet Approved* 19 20200630_ts_24_206 (i) The Hearing Officer may continue the hearing from time to time, in his or her sole discretion, to allow for its orderly completion. After receiving the evidence submitted at the hearing, the Hearing Officer may further continue the hearing and request additional information from either the Department or the Retailer. (j) After considering the evidence and testimony submitted the Hearing Officer shall issue a written decision regarding the matters properly raised in the request for administrative hearing. The Hearing Officer’s decision shall: (1) Be based on a preponderance of the evidence. (2) Include a statement of the reasons for the decision. (3) Be issued within 20 calendar days of the close of the hearing. (4) Be served on both the Retailer and the Department. The decision shall be given to the Retailer either by email, if requested, or by first class mail, postage prepaid. (k) Based on the Hearing Officer’s decision, the Office of the County Hearing Officer shall promptly refund to the Retailer any amount of the advance fine deposit the Department is not entitled to and shall provide the remainder to the Department. (l) The Hearing Officer’s written decision shall constitute the final administrative decision of the City. 4.64.160. Enforcement. (a) Any violation of this Chapter is hereby declared to be a public nuisance. (b) Causing, permitting, aiding, abetting, or concealing a violation of any provision of this Chapter shall also constitute a violation of this Chapter. (c) Whenever evidence of a violation of this Chapter is obtained in any part through the participation of an individual under the age of 21 years old, such an individual shall not be required over his or her objection to appear or give testimony in any civil or administrative process brought to enforce this Chapter and the alleged violation shall be adjudicated based upon the sufficiency and persuasiveness of the evidence presented. (d) Violations of this Chapter may be remedied by a civil action brought by the City Attorney or Santa Clara County Counsel, including, but not limited to, administrative or judicial nuisance abatement proceedings, civil code enforcement proceedings, and suits for injunctive relief. For the purposes of the civil remedies provided in this Chapter, each day on which a Tobacco Product is offered for Sale in violation of this Chapter, and each *Not Yet Approved* 20 20200630_ts_24_206 individual retail Tobacco Product that is Sold or Distributed in violation of this Chapter, shall constitute a separate violation of this Chapter. (e) Any Person found guilty of violating any provision of this Chapter shall be deemed guilty of an infraction, punishable as provided by California Government Code § 25132. (f) The remedies provided by this Chapter are cumulative and in addition to any other remedies available at law or in equity. 4.64.170. No conflict with federal or state law. Nothing in this Chapter shall be interpreted or applied so as to create any requirement, power, or duty that is preempted by, or in conflict with, federal or state law, rules, or regulations. SECTION 3. If any section, subsection, clause or phrase of this Ordinance is for any reason held to be invalid, such decision shall not affect the validity of the remaining portion or sections of the Ordinance. The Council hereby declares that it should have adopted the Ordinance and each section, subsection, sentence, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses or phrases be declared invalid. SECTION 4. The Council finds that this project is exempt from the provisions of the California Environmental Quality Act (“CEQA”), pursuant to Section 15061 of the CEQA Guidelines, because it can be seen with certainty that there is no possibility that the ordinance will have a significant effect on the environment. // // // // // // // // // *Not Yet Approved* 21 20200630_ts_24_206 SECTION 5. This ordinance shall be effective on the thirty-first day after the date of its adoption. INTRODUCED: PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: ____________________________ ____________________________ City Clerk Mayor APPROVED AS TO FORM: APPROVED: ____________________________ ____________________________ Deputy City Attorney City Manager ____________________________ Director of Public Works ____________________________ Chief of Police ____________________________ Director of Administrative Services CITY OF PALO ALTO OFFICE OF THE CITY CLERK August 3, 2020 The Honorable City Council Palo Alto, California SECOND READING: Adoption of an Ordinance to Reduce the Number of Human Relations Commission and Public Art Commission Members From Seven to Five (FIRST READING: June 22, 2020 PASSED: 5-2 Kou, Tanaka no) This was first heard by the City Council on June 22, 2020 on the Consent Calendar. It was passed on a vote of 5-2 Kou, Tanaka no. It is now before the City Council for the second reading. ATTACHMENTS: • Attachment A – Ordinance Amending Chapters 2.18 and 2.22 to Reduce PAC and HRC from 7 to 5 Members (PDF) Department Head: Beth Minor, City Clerk Page 2 *NotYetApproved* 1 208_20200604_ts_24 OrdinanceNo._____ OrdinanceoftheCounciloftheCityofPaloAltotoAmendChapter2.18(PublicArt Commission)andChapter2.22(HumanRelationsCommission)toReduceEachCommissionto FiveMembers TheCounciloftheCityofPaloAltoORDAINSasfollows: SECTION1.Chapter2.18(PublicArtCommission)ofthePaloAltoMunicipalCodeis herebyamendedandrestatedasfollows(deletedtextisinstrikethrough,newtextisunderlined): 2.18.010Membership. Thereiscreatedapublicartcommissioncomposedofsevenfivememberswhoarenotcouncil members,officers,oremployeesofthecity,andwhoshallbeappointedbythecitycouncil. 2.18.020Qualificationsofmembers. Membersofthepublicartcommissioneithershallbemembersofthearchitecturalreview boardorshallbeprofessionalvisualartists,professionalvisualartseducators,professionalvisual artsscholars,orvisualartscollectorswhoseauthoritiesandskillsareknownandrespectedinthe communityand,wheneverfeasible,whohavedemonstratedaninterestin,andhaveparticipated in,theartsprogramofthecity. 2.18.040Termofoffice. TermsofofficeonthePublicArtCommissionshallbethreeyears.Commissionappointments shallbestaggeredsothatthree(3)membersareappointedin2018andeverythreeyears thereafter,one(1)memberisappointedin2019andeverythreeyearsthereafter,andone(1) memberisappointedin2020andeverythreeyearsthereafter.Termsofofficeshallcommence onthefirstdayofJuneandendonthelastdayofMay.andfour(4)membersareappointedin 2017andeverythreeyearsthereafterEffectiveJanuary1,2016,termsofofficeduetoexpireon April30ofeachyearshallbeextendedtoexpireonMay31ofthesameyear,andthereafter termsofofficeshallcommenceonthefirstdayofJune.Ifasuccessorisunavailable,amember mayremaininofficeuntilhisorhersuccessorisappointed. 2.18.050Officers,meetings,andprocedures. (a)Chairperson.Thepublicartcommissionshallselectoneofitsmembersaschairperson, whoshallholdofficeforoneyearoruntilasuccessoriselected,unlessthechairperson'stermas amemberofthepublicartcommissionexpiressooner. (b)Meetings.Thepublicartcommissionshallestablisharegulartimeandplaceofmeeting andshallholdatleastoneregularmeetingamonth.Specialmeetingsmaybecalledbythe chairpersonorbyanythreemembersofthepublicartcommissionuponpersonalnoticebeing *NotYetApproved* 2 208_20200604_ts_24 giventoallmembersorbywrittennoticebeingmailedtoeachmembertwentyͲfourhoursprior tosuchmeetingunlesssuchnoticerequirementiswaivedinwriting. (c)Procedures.Thepublicartcommissionshallprescribebylaws,forms,applications,rules, andregulationsfortheconductofitsbusiness.Allmeetingsofthepublicartcommissionshallbe opentothepublicandaresubjecttoTitle5,Division2,Part1,Chapter9oftheCalifornia GovernmentCodeorsuccessorlegislation.Thedecisionsofthepublicartcommissionshallbe transmittedtothedirectorofartsandcultureandtosuchotherbodyorbodieswhichhave jurisdictiontoreviewtheprojectunderconsideration. 2.18.070Jurisdiction. (a)ArtinPublicPlaces.Thepublicartcommissionshallperformthedutiesandshallhave theresponsibilitiesspecifiedinChapter2.26ofthistitle. (b)AdditionalDuties.Thepublicartcommissionshallperformsuchotherdutiesand undertakesuchotherresponsibilitiesasthecitycouncilmaydirectfromtimetotime. (c)InteractionwithOtherCityBodies.Ifthefunctionsofthepublicartcommissionoverlap thefunctionsofanothercitycommittee,commission,board,taskforce,orthelike,thedirector ofartsandculture,incooperationwiththepublicartcommissionandsuchothercitybody,shall deviseaprocedureforcoordinatingsuchfunctionstoavoidduplicationofefforts,tomaximize cooperationbetweenthecitybodies,andtoutilizetheexpertiseofthevariouscitybodiesina mannermostcompatiblewiththepublicwelfare. (d)InteractionwithCityDepartments.Thechiefbuildingofficialshalldeterminewhethera proposedworkofartisamuralorasignunderSection16.20.011(a)(10)ofthiscodepriorto reviewbythepublicartcommission. SECTION2.Chapter2.22(HumanRelationsCommission)ofthePaloAltoMunicipal Codeisherebyamendedandrestatedasfollows(deletedtextisinstrikethrough,newtextis underlined): 2.22.010Membership. ThereiscreatedaHumanRelationsCommissioncomposedofsevenfivememberswhoarenot councilmembers,officersoremployeesofthecity,whoareresidentsofthecity,andwhoshall beappointedbythecitycouncil. 2.22.020Termofoffice. TermsofofficeontheHumanRelationsCommissionshallbethreeyears.Commission appointmentsshallbestaggeredsothattwo(2)membersareappointedin2018andeverythree yearsthereafter,two(2)membersareappointedin2019andeverythreeyearsthereafter,and one(1)memberisappointedin2020andeverythreeyearsthereafter.Termsofofficeshall commenceonthefirstdayofJuneandendonthelastdayofMay.EffectiveJanuary1,2016, termsofofficeduetoexpireonApril30ofeachyearshallbeextendedtoexpireonMay31of *NotYetApproved* 3 208_20200604_ts_24 thesameyear,andthereaftertermsofofficeshallcommenceonthefirstdayofJune.Ifa successorisunavailable,amembermayremaininofficeuntilhisorherasuccessorisappointed. 2.22.030Officers,meetingsandprocedures. (a)Thecommissionshallelectoneofitsmemberschairpersonwhoshallholdofficeforone yearanduntilhisorherasuccessoriselectedunlesshisorherthechairperson’stermasa memberofthecommissionsoonerexpires. (b)TheHumanRelationsCommissionshallestablisharegulartime,dateandplaceofmeeting andshallordinarilyholdmeetingsmonthlyThecommissionshallestablisharegulartimeand placeofmeetingandshallholdatleastoneregularmeetingamonth.Specialmeetingsmaybe calledbythechairpersonorbyanyfourthreemembersofthecommissionuponpersonalnotice beinggiventoallmembersorbywrittennoticebeingmailedtoeachmembertwentyͲfourhours priortosuchmeetingunlesssuchnoticerequirementiswaivedinwriting. (c)FourThreeofthesevenfivemembersshallconstituteaquorumandtheaffirmativevotes offouramajorityofmemberspresentarerequiredtotakeanyaction. (d)Thecommissionmayestablishtaskforcesadhoccommitteesoftwocommissionmembers foradvisoryandinvestigativepurposes.Thecommissionshall,bymajorityvote,appoint membersoftaskforcesadhoccommittees,suchtaskforcememberstobeapprovedbythe mayor.Membersofthecommissionmaybeappointedasmembersofataskforce. 2.22.050Jurisdiction. (a)Thehumanrelationscommissionhasthediscretiontoactwithrespecttoanyhuman relationsmatterwhenthecommissionfindsthatanypersonorgroupdoesnotbenefitfullyfrom publicorprivateopportunitiesorresourcesinthecommunity,orisunfairlyordifferentlytreated duetofactorsofconcerntothecommission. (1)Publicorprivateopportunitiesorresourcesinthecommunityinclude,butarenotlimited to,thoseassociatedwithownershipandrentalofhousing,employment,educationand governmentalservicesandbenefits. (2)Factorsofconcerntothecommissioninclude,butarenotlimitedto,socioeconomicclass orstatus,physicalconditionorhandicap,marriedorunmarriedstate,emotionalcondition, intellectualability,age,sex,sexualpreference,genderidentity,race,culturalcharacteristics, ethnicbackground,ancestry,citizenship,andreligious,conscientiousorphilosophicalbelief. (b)Thecommissionshallconductsuchstudiesandundertakesuchresponsibilitiesasthe councilmaydirect. 2.22.060Authority. UponmakingafindingpursuanttoSection2.22.050(a),thecommissionmayactasfollows: (a)Tofosterpublicawarenessandunderstandingofhumanrelationsproblemsbyanymeans ofdisseminatinginformationincluding,butnotlimitedto,educationalprogramsandprintedand electronicmedia; *NotYetApproved* 4 208_20200604_ts_24 (b)Tofacilitateresolutionofproblemsorimprovementofconditionswithinthejurisdiction ofthecommissionbyencouragement,persuasionandmediationandbypointingoutprivateor publicagencieswhichmightprovideassistance; (c)Tomakesuchstudieswhich,inthejudgmentofthecommission,mightaidinaffecting matterswithinthejurisdictionofthecommission; (d)Torecommendlocallegislationorotheractiontothecouncilandtoencouragethe counciltosupportoropposestateorfederallegislationorregulationrelatingtomatterswithin thejurisdictionofthecommission; (e)Tocoordinateprogramsofthecommissionwithsimilarprogramsbyprivateandpublic agenciesandorganizations;and (f)Torecommendoropposelegislationotherthanthatofthecity,providedthatthecity councilhasnottakenanofficialpositionwithrespecttosuchlegislation,andprovidedfurther thatanycommunication,whetheroralorwritten,fromthecommissionconcerningsuch legislationclearlyindicatesthatsuchrecommendationoroppositionisthatofthecommission andisnotnecessarilythatofthecitycouncil. 2.22.070Liberalconstruction. Theprovisionsofthischaptershallbeliberallyconstruedtoeffectuatethepublicpurposeof fosteringhumanrelations. SECTION3.Ifanysection,subsection,clauseorphraseofthisOrdinanceisforany reasonheldtobeinvalid,suchdecisionshallnotaffectthevalidityoftheremainingportionor sectionsoftheOrdinance.TheCouncilherebydeclaresthatitshouldhaveadoptedthe Ordinanceandeachsection,subsection,sentence,clauseorphrasethereofirrespectiveofthe factthatanyoneormoresections,subsections,sentences,clausesorphrasesbedeclared invalid. SECTION4.TheCouncilfindsthatthisprojectisexemptfromtheprovisionsofthe CaliforniaEnvironmentalQualityAct(“CEQA”),pursuanttoSection15061oftheCEQA Guidelines,becauseitcanbeseenwithcertaintythatthereisnopossibilitythattheordinance willhaveasignificanteffectontheenvironment. // // // // // *NotYetApproved* 5 208_20200604_ts_24 SECTION5.ThisordinanceshallbeeffectiveonthethirtyͲfirstdayafterthedateofits adoption. INTRODUCED: PASSED: AYES: NOES: ABSENT: ABSTENTIONS: ATTEST: ____________________________ ____________________________ CityClerkMayor APPROVEDASTOFORM:APPROVED: ____________________________ ____________________________ DeputyCityAttorneyCityManager ____________________________ DirectorofCommunityServices DepartmentDivision CITY OF PALO ALTO OFFICE OF THE CITY CLERK August 3, 2020 The Honorable City Council Palo Alto, California Selection of Applicants to Interview for one Position on the Human Relations Commission and two Positions on the Public Art Commission Recommendation Direct Staff to schedule interviews with all applicants for scheduled vacancies. Discussion A total of 14 applications have been submitted during this recruitment period. Staff is requesting the City Council select the candidates to be interviewed for: • One position on the Human Relations Commission (Xue resigned), filling a vacancy due to a resignation, with a term ending May 31, 2021 • Two positions on the Public Art Commission, with terms ending May 31, 2023 A date for interviews will be scheduled as soon as possible and is to be determined based on the availability of the City Council. Copies of all applications are attached to this staff report. Some applications may be redacted at the request of the applicant. A full set of non-redacted applications will be provided to Council Members directly. Background On April 20, 2020, the City Council directed Staff to reduce the number of members on the Human Relations Commission and Public Art Commission from seven to five. The second reading of the Ordinance reducing the number of members on these Commissions is scheduled for August 3, 2020. On April 20, the Council also directed Staff to reopen the recruitment for the Human Relations Commission and Public Art Commission. The City Clerk’s Office advertised this recruitment from June 2, 2020 through July 21, 2020, satisfying the 15-day minimum advertising period outlined in Municipal Code Section 2.16.060(a). Advertising included placements in the Daily Post newspaper, Palo Alto Online Express email, Palo Alto Weekly newspaper; promotion on the City’s website and social media; and inclusion in weekly Council Packet GovDelivery notifications. During the last several recruitments, Council has elected to interview all applicants for respective Boards and Commissions. Applicants Human Relations Commission (One position with a partial term expiring May 31, 2021) Page 2 1. Nilofer Chollampat 2. Sunita de Tourreil 3. Sofia Fojas 4. Curt Kinsky 5. David Villaseca Morales 6. Paul Rugg 7. Lestina Trainor Public Art Commission (Two positions with terms expiring May 31, 2023) 1. Djibril Drame 2. Marilyn Gottlieb-Roberts 3. Shannon Rose McEntee 4. Radina Philyaw 5. Hsinya Shen (Incumbent) 6. Harriet Stern 7. Katherin Talbot 8. Nia Taylor (Incumbent) ATTACHMENTS: • Attachment A: HRC and PAC Applications 2020 (PDF) Department Head: Beth Minor, City Clerk Page 3 Boards and Commission Applications Spring/Summer 2020 Recruitment Human Relations Commission and Public Art Commission Human Relations Commission: 1. Nilofer Chollampat 2. Sunita de Tourreil 3. Sofia Fojas 4. Curt Kinsky 5. David Villaseca Morales 6. Paul Rugg 7. Lestina Trainor Public Art Commission: 1. Djibril Drame 2. Marilyn Gottlieb-Roberts 3. Shannon Rose McEntee 4. Radina Philyaw 5. Hsinya Shen (Incumbent) 6. Harriet Stern 7. Katherin Talbot 8. Nia Taylor (Incumbent) Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission 4IVWSREP-RJSVQEXMSR 2EQI %HHVIWW 'IPP4LSRI CC ,SQICC 3JJMGI4LSRI )QEMP %VI]SYE4EPS%PXS6IWMHIRX#CC=IWCC2S (S]SYLEZIER]VIPEXMZIWSVQIQFIVWSJ]SYVLSYWILSPH[LSEVIIQTPS]IHF]XLI'MX]SJ4EPS%PXS[LS EVIGYVVIRXP]WIVZMRKSRXLI'MX]'SYRGMPSV[LSEVI'SQQMWWMSRIVWSV&SEVH1IQFIVW#CC=IWCC2S %VI]SYEZEMPEFPIERHGSQQMXXIHXSGSQTPIXIXLIXIVQETTPMIHJSV#CC=IWCC2S 'EPMJSVRMEWXEXIPE[VIUYMVIWETTSMRXIHFSEVHERHGSQQMWWMSRQIQFIVWXSJMPIEHIXEMPIHHMWGPSWYVISJ XLIMVJMRERGMEPMRXIVIWXW*EMV4SPMXMGEP4VEGXMGIW'SQQMWWMSR'SRJPMGXSJ-RXIVIWX*SVQ (S]SYLEZIERMRZIWXQIRXMRSVHS]SYWIVZIEWERSJJMGIVSVHMVIGXSV SJEGSQTER]HSMRKFYWMRIWWMR4EPS%PXS[LMGL]SYFIPMIZIMWPMOIP]XS IRKEKIMRFYWMRIWW[MXLXLI'MX] TVSZMHITVSHYGXWSVWIVZMGIWJSV'MX]TVSNIGXWSV FIEJJIGXIHF]HIGMWMSRWSJXLIFSEVHSVGSQQMWWMSR]SYEVIETTP]MRKJSV#CC=IWCC2S )\GPYHMRK]SYVTVMRGMTEPVIWMHIRGIHS]SYS[RVIEPTVSTIVX]MR4EPS%PXS#CC=IWCC2S ,S[HMH]SYIEVREFSYXXLIZEGERG]SRXLI,YQER6IPEXMSRW'SQQMWWMSR# CC'SQQYRMX]+VSYT CC)QEMPJVSQ'MX]'PIVO CC4EPS%PXS;IIOP] CC(EMP]4SWX CC'MX];IFWMXI CC*P]IV 3XLIV CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 0MWX VIPIZERX IHYGEXMSR XVEMRMRK I\TIVMIRGI GIVXMJMGEXIW SJXVEMRMRK PMGIRWIW SV TVSJIWWMSREP VIKMWXVEXMSR 4EKI ,YQER6IPEXMSRW'SQQMWWMSR(%:-( :-00%7)'% 136%0)7 HEZMH$HEZMHZMPPEWIGEGSQ +PSFEP ,IEH SJ '< 1EVOIXMRK 7EPIW 3VEGPI *MRERGMEP 7IVZMGIW +VSYT *SV ]IEVW - LEZI FYMPX QYPXMHMWGMTPMREV] XIEQW ERH FYWMRIWW MR GSYRXVMIW 97% )1)%0%8%1 %4%' f JSV 3VEGPI %GGIRXYVI &&:% 'SGE'SPE *ERXE 0:1, 47% 4IYKISX 'MXVSÌR ERH 7ERXERHIV &7 &YWWMRIWW 0E[ -RXIVREXMSREP (MTPSQE JVSQ 9'&IVOIPI] )YVSTIER 0E[]IV &SVR MR 7TEMR JEXLIV SJ HEYKLXIVW (%:-( :-00%7)'% 136%0)7 )QTPS]QIRX 4VIWIRXSV0EWX)QTPS]IV 3GGYTEXMSR (IWGVMFI]SYVMRZSPZIQIRXMRGSQQYRMX]EGXMZMXMIWZSPYRXIIVERHGMZMGSVKERM^EXMSRW ;LEXMWMXEFSYXXLI,YQER6IPEXMSRW'SQQMWWMSRXLEXMWGSQTEXMFPI[MXL]SYVI\TIVMIRGIERH SJWTIGMJMGMRXIVIWXXS]SYERH[L]# 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 3VEGPI 8IGLRSPSK]SR 'YWXSQIV )\TIVMIRGI(MKMXEP &EROMRK -RZSPZIH MR VIWIVGL KVSYT SR KIRHIV WTIGMPM^IH SR [SQIR IRXVITVIRIYV 4YVWYMRK 4L( [MXL TYFPMGEXMSRW SR KIRHIV ERH IRXVITVIRIYVWLMT *SVQIV %HZMWSV SJ '13 'SYRGMP WYTTSVXMRK FYWMRIWW TVSKVIWW 3R E TIVWSREP WMHI - EQ ER MRQQMKVERX MR 4EPS %PXS GSQMRK JVSQ 7TEMR ERH XV]MRK XS WYTTSVX ERH KMZI FEGO XS XLI GSQQYRMX] 3RXLITVSJIWWMSREPWMHI-EQJSGYWIHSRLYQERM^MRKXLIXIGLRSPSK]EWE [E] XS MRGPYHI IZIV]FSH] 3R E WGMIRXMJMG VIWIEVGL WMHI - EQ JSGYWIH SR WYTTSVXMRK [SQIR IRXVITVIRIYVW [SVPH[MHI ERH SR E PSGEP FEWMW HYI XS XLIMV PS[IV TVIWIRGI MR QER] GSYRXVMIW (%:-( :-00%7)'% 136%0)7 4PIEWIHIWGVMFIERMWWYIXLEXVIGIRXP]GEQIFIJSVIXLI'SQQMWWMSRXLEXMWSJTEVXMGYPEVMRXIVIWX XS]SYERHHIWGVMFI[L]]SYEVIMRXIVIWXIHMRMX-J]SYLEZIRIZIVFIIRXSE'SQQMWWMSRQIIXMRK ]SYGERZMI[EREVGLMZI 0-2/ -JETTSMRXIH[LEXWTIGMJMGKSEPW[SYPH]SYPMOIXSWIIXLI,YQER6IPEXMSRW'SQQMWWMSR EGLMIZIERH[L]#,S[[SYPH]SYWYKKIWXEGGSQTPMWLMRKXLMW# 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 6IPIZERGI SJ GMZMG IRKEKIQIRX SJ JEQMPMIW MR GLMPHGEVI TVSKVEQ SR XLI 3GXSFIV XL WIWWMSR &IEGYWI SJ XLI RIIH ETTSMRXIH XS EJJSVHEFPI GLMPHGEVI EW [IPP EW MRZSPZMRK JEQMPMIW -RXIVIWXMRK XLI FIRGLQEVOMRK MR XLMW GEWI 4MXXWFYVKL XS IRLERGI XLI PMJI UYEPMX] SJ 4EPS %PXS GMXM^IRW -RXIKVEXMSR SJ MRQMKVERX JEQMPMIW EGVSWW KIRHIV VEGI SV EKI ,YQERM^MRK XIGLRSPSK] EW E [E] XS GSRRIGX XLI GSQQYRMX] *SWXIV IRXVITVIRIYVW RS QEXXIV XLI KIRHIV 8LIWI KSEPW [SYPH FI YWIJYP XS MRXIKVEXI XLI GSQQYRMX] EW [IPP EW MRGVIEWI XLI UYEPMX] SJ PMZMRK SJ %00 4EPS %PXS GMXM^IRW (%:-( :-00%7)'% 136%0)7 ,YQER6IPEXMSRW'SQQMWWMSR1IQFIVW[SVO[MXLXLIHSGYQIRXWPMWXIHFIPS[-J]SYLEZI I\TIVMIRGI[MXLER]SJXLIWIHSGYQIRXWTPIEWIHIWGVMFIXLEXI\TIVMIRGI)\TIVMIRGI[MXLXLIWI HSGYQIRXWMWRSXVIUYMVIHJSVWIPIGXMSR ,YQER7IVZMGIW2IIHW%WWIWWQIRX 0-2/ 1YRM'SHI §1ERHEXSV]6IWTSRWI4VSKVEQ 0-2/ 'SQQYRMX]7IVZMGIW)PIQIRXSJXLI'SQTVILIRWMZI4PER 0-2/ 'SRWIRXXS4YFPMWL4IVWSREP-RJSVQEXMSRSRXLI'MX]SJ4EPS%PXS;IFWMXI 'EPMJSVRME+SZIVRQIRX'SHI7IGXMSRWXEXIWMRTEVX©2SWXEXISVPSGEPEKIRG]WLEPPTSWXXLI LSQI EHHVIWW SV XIPITLSRI RYQFIV SJ ER] IPIGXIH SV ETTSMRXIH SJJMGMEP SR XLI -RXIVRIX [MXLSYX JMVWX SFXEMRMRKXLI [VMXXIRTIVQMWWMSRSJ XLEXMRHMZMHYEPª8LMWGSRWIRXJSVQ[MPPRSX FIVIHEGXIHERH[MPPFI EXXEGLIHXSXLI%TTPMGEXMSRERHTSWXIHXSXLI'MX]¬W[IFWMXI 8LIJYPPGSHIGERFIVIEHLIVI 0-2/ 6IEHXLIGSHIERHGLIGOSRP]32)STXMSRFIPS[ -KMZITIVQMWWMSRJSVXLI'MX]SJ4EPS%PXSXSTSWXXSXLI'MX]¬W[IFWMXIXLIEXXEGLIH&SEVHERH 'SQQMWWMSR%TTPMGEXMSRMRXEGX-LEZIVIEHERHYRHIVWXERHQ]VMKLXWYRHIV+SZIVRQIRX'SHI 7IGXMSR-QE]VIZSOIXLMWTIVQMWWMSREXER]XMQIF]TVSZMHMRK[VMXXIRRSXMGIXSXLI4EPS %PXS'MX]'PIVO 36 -VIUYIWXXLEXXLI'MX]SJ4EPS%PXSVIHEGXQ]LSQIEHHVIWWTLSRIRYQFIVWERHIQEMPEHHVIWW JVSQXLIEXXEGLIH&SEVHERH'SQQMWWMSR%TTPMGEXMSRTVMSVXSTSWXMRKXSXLI'MX]¬W[IFWMXI-EQ TVSZMHMRKXLIJSPPS[MRKEPXIVREXIMRJSVQEXMSRERHVIUYIWXXLEXXLI]YWIXLIJSPPS[MRKGSRXEGX MRJSVQEXMSRMRWXIEH %HHVIWW 'IPP4LSRI CC,SQICC3JJMGI4LSRI )QEMP 7MKREXYVI CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC (EXI CCCCCCCCCCCCC 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 1MHXS[R 4EPS %PXS HEZMH$HEZMHZMPPEWIGEGSQ (%:-( :-00%7)'% 136%0)7 Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Lestina Trainor 32 Roosevelt Circle 203 482 2262 203 482 2262 lestina.trainor1@gmail.com 4 Boston College, BA Fordham University School of Law, JD Member of the Bar: New York, Connecticut Attorney 1998 - 2016 Lestina Trainor Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission Self Attorney Board of Directors, Family & Childrens Aid 2005 - present Guided executive team through tremendous growth and expansion over 15 years. Active in developing board governance, overseeing agency programs, acquisition of real estate and most recently, creating a task force to evaluate and implement changes to address systemic racism and inequity agency-wide, including on the Board of Directors. Board of Directors, League of Women Voters, Redding CT 2013 - 2019 In the wake of the Newtown Elementary school shooting, collected state-wide gun violence data and prepared a comprehensive study. Regular speaker at luncheons & panel discussions. Board of Directors, Connecticut Against Gun Violence 2013 - 2017 Founding member of March for Change, a grassroots movement demanding sensible gun legislation. Organized Valentines Day 2013 protest at the the state capitol building in Hartford attended by approximately 10k. Testified before state congress on multiple occasions. Board of Directors, Ridgefield Academy 2006 - 2008 Drafted school mission statement for Diversity & Inclusion. Organized/hosted fundraisers. Chairperson, The Fresh Air Fund 2009 - 2016 Recruited and vetted families in Connecticut to be summertime hosts to chil I recently moved to Palo Alto from the east coast. However, Ive spent a lifetime visiting Palo Alto to see my grandparents and other relatives. So in some respects, moving here feels a bit like coming home. I have always been an active participant in my community. I inherited this trait from both of my parents. Mom still tutors a linty of ESL students at the Mitchell Park and Rinconada librariesthough shes well past retirement age; and dad too, was an active volunteer teaching music in east bay schools until he passed away in 2009. I am eager to find my own volunteer opportunities in town. Not only do I love lending my talents to help make my community a better place, but I love meeting other people who share the same interest. Specifically, the HRC appeals to me because I have always been interested in advocating for vulnerable populations. My parents adopted a 3 year old boy when I was six. From that day on, I got an up close view of the many social/societal problems that surrounded the circumstances of his adoption: why he was up for adoption in the first place; the effects of foster care and multiple placements, the resulting setbacks in education and socialization that my brother faced. It really shaped our entire childhood. It also sparked my desire to study law with the intent of practicing child advocacy. Although my first job offer led my law practice in a different direction, I have continuously satisfied my need to serve and advocate for children through my volunteer work. Lestina Trainor 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission I just recently became aware of the HRC last week when I watched a Zoom Virtual Town Hall presented by Embarcadero Media entitled Race, Policing and the Color of Justice, sponsored by Palo Alto Online. I believe Police Chief Bob Jonsen mentioned the HRC in connection with his anticipating input from the Commission. I was so impressed by the discussion and panelists that I immediately set out Googling each of the speakers and researching ways that I could possibly could get involved with the conversation. The next day I happened upon a You-Tube Q & A with Reverend Kaloma Smith, Chief Jonsen and City Manager Ed Shikada. I was further intrigued, inspired and energized by the panelists intelligence, optimism and willingness to engage on the tough subjects of systematic racism and policing. In my volunteer work I have chaired several Diversity & Inclusion Committees, drafted mission statements and policies pertaining to equity, and evaluated institutions for implicit bias, etc etc. Law school only deepened my understanding of issues surround racial justice, constitutional law, and the criminal justice system. With a father who hailed from Birmingham, Alabama and who had been a student activist and personal associate of Martin Luther King, Jr. I have been studying this topic for as long as I can remember. I believe my voice would add great value to the HRC on this topic and beyond. I would love to see the Human Relations Committee come up with a list of recommendations to be adopted by PAPD that effect significant and meaningful change. The goal: to have a reimagined system of policing in Palo Alto where (ultimately) all residents feel safe and protected by PAPD. In just in the short time that I have been a resident, I have been made aware of several police incidents that definitely warrant further unpacking. I have also been told about, and read several accounts by, residents who defiantly have a deep (and warranted) distrust of the police. I feel strongly that now is the time to make significant changes to benefit the community as a whole. I loved the enthusiastic general consensus of Chiefs Jonsen, East PA Chief Pardini and former East PA Chief Ron Davis, on the Embarcadero Media Virtual Town Hall, that NOW is a unique opportunity to enact swift, meaningful and impactful change. I believe this can be accomplished by gathering as much anecdotal evidence as we can. Looking for patterns; looking at existing policies and procedures and evaluating if they are being followed or not. Then exploring how some existing procedures may be problematic because they have a disparate impact on Black people and POC. I understand that PAPD is already quite close to meeting 8 Cant Wait standard. Good, but I think we can go beyond that baseline. Id also love to explore what changes could possibly be achieved by challenging police union policies & state laws that sometimes diminish the authority of local police chiefs. Lestina Trainor 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission July 6, 2020 I have not worked with the specific documents attached. However in my capacity as an attorney I am accustomed to working with whatever document comes across my desk. I very much enjoy the process of digesting new information and interpreting/analyzing same. Lestina Trainor Public Art Commission Application 1 of 5 Personal Information Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Ph ____ Home / ____ Office Phone: E-mail: Are you a Palo Alto Resident? ____ Yes ____ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? ____ Yes ____ No Are you available and committed to complete the term applied for? ____ Yes ____ No California state law and the Ci require appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1)engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? ____ Yes ____ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? ___ Yes ___ No How did you learn about this vacancy? ____ Community Group ____ Email from City Clerk ____ Palo Alto Weekly ____ Daily Post ____City Website ____ Flyer Other: List relevant education, training, experience, certificates of training, licenses, or professional registration: 'IVXMJMGEXMSRSJ1YWMG:MHIS'IVXMJMGEXMSRSJ%VXW'YVEXMSR&EGLIPSV MR.SYVREPMWQ'SQQYRMGEXMSRERH4YFPMG6IPEXMSRW (NMFVMP(VEQI 7SYXL7]GEQSVI%ZIRYI dramedjibril@gmail.com Public Art Commission Application 2 of 5 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? ,EZIFIIRMR%VXWSZIVXLER]IEVW*VSQWXVIIXEVXTLSXSKVETL] JMPQERHTIVJSVQERGI 3VKERM^MRKGYVEXMRKGVIEXMRKI\GLERKMRKEVIWSQITSMRXWXLEXPMROQI [MXL4YFPMG%VX'SQQMWWMSR 1]GSQTEXMFMPMX][MXLXLMWTSWXMWXLEX-LEZIFIIRHSMRKKVEJJMXM WMRGI]IEVWSPHXLIRW[MXGLMRXSTLSXSKVETL]MREWE TVSJIWWMSREPFIIRHSGYQIRXMRKXLIKVEJJMXMWGIRIMR(EOEVWMRGI *VSQXLSWIHSGYQIRXEXMSR-QEHIETVSNIGXGEPPIH1]'SPSVJYP'MX]XLEX [IRXXS+IVQER]7IRIKEPERH-ZSV]'SEWX %JXIVGYVEXMRKEPSXSJI\LMFMXMSRWPEWX]IEV-LEZIHIGMHIHXSJSPPS[ E[SVOWLSTMRXS%VXW'YVEXMSRSVKERM^IHF]-RHITIRHIRX'YVEXSVW -RXIVREXMSREPMR(EOEV%QSRKXLIXIEGLIVW[ILEH7MQSR2NEQMEGXYEP GYVEXSVJSVXLI&MIRREPISJ(EOEV*VEROPMR7MVQERWSJXLI1MEQM4IVI^ 1YWIYQ -HSFIPMIZIXLEXQ]I\TIVMIRGI[MPPLIPTQIXSJMX 1MRMWXV]SJ0SGEP+SZIVRERGIMR7IRIKEP %WWMWXERXMR'SQQYRMGEXMSR &EGOLSQIMR7IRIKEP-LEZIFIIRMRZSPZIMRXSGSQQYRMX]SVKERM^EXMSRW ZSPYRXIIVMRKMRHMJJIVIRXRSRTVSJMXPMOI7IRIGS[MGLMWERSRTVSJMX JMKLXMRKEKEMRWXTSPPYXMSR -RWXIEHSJXLEX-LEZIFIIREPIEHIVMR(EOEV'VIEXMZI7GIRILIPTMRK HMJJIVIRXTIIVWXSWIXYTI\LMFMXMSRWGSRXEGXMRKTVIWWGYVEXMRK Public Art Commission Application 3 of 5 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? 3RISJXLIMWWYIXLEXGEQIFIJSVIXLIGSQQMWWMSRMWXLIHMZIVWMX]SJ XLI[SVOWERHXLIWYFNIGXW-[SYPHPSZIXSXEPOEFSYXQSVIXLI EGGITXERGISJKE]GSQQYRMX]ERHLS[XSLIPTXLI[SVPHXSI\GLERKIERH PMZIXSKIXLIV -[SYPHPSZIXSWIIQSVIHMZIVWMX]0SZIEGGITXERGIPMFIVX]TIEGI NS] 1]KSEPWEVIXSFVMRKEGGITXERGIERHVIWTIGXXLVSYKLEVXW%RH-HS FIPMIZIXLEXXLISRP]TPEXJSVQXLEXGERLIPTQIXSEGLMIZIMXMW4EPS %PXS4YFPMG%VX'SQQMWWMSR Public Art Commission Application 4 of 5 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Municipal Arts Plan -RIZIVJEGIHXS[SVO[MXLXLMWHSGYQIRX8LMWMWXLIJSVXWXMQIXLEX- LEZIFIIRWIIMRKXLMW-[SYPHPSZIXSKIXXSORS[EFSYXXLIHSGYQIRX F]KIXXMRKMRXSXLI'SQQMWWMSR Public Art Commission Application 5 of 5 Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, This consent form will not be redacted and will be attached The full code can be read here: Read the code, and check only ONE option below: _ Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: ____ Home / ____ Office Phone: ___________________________________________________ Email: ____________________________________________ The phone number / address can be nonpublic and different than the address collected on page one. (Optional) Additional Attachment(s) If you would like to submit a resume, work sample, etc. along with your Application, HVEQIHNMFVMP$KQEMPGSQ 7SYXL7]GEQSVI%ZIRYI Djibril DRAME 1264 South Sycamore Avenue, Los Angeles, CA 90019 E-mail: dramedjlbrll@gmall.com Tel:+1{323) 723 64 20 Profile: Artistic-Photographer I PR & Communications I Journalist I Curator Languages: French & English Domain: Public relations I Visual Art I Consultancy I Journalism I Publishing I Curator Computer: Microsoft Office I Lightroom I Social Media (Facebook, Twitter, lnstagram, Tumblr) 2013 2008 2007 2007 November 2016 November 2015 Oct -Nov. 2015 Sept. -Oct. 2013 Jan 2013 September -Nov. 2012 March -Sept. 2012 June 2011 Nov. 2009 -Dec. 2010 2009 2009 2016 2011 2015 QUALIFICATIONS lnstltut Superteur des Sciences de l'lnformatfon et de la Communication, Dakar, Senegal Bachelors' Degree, Journalism and Communications Major: Public Relations Unfversfte Chefkh Ania Diop, Dakar, Senegal l st Year of Bachelors' Degree : English Certmcate in Music Video Direction Dakar, Senegal Groupe Scolalre Mauamba, Dakar, Senegal Baccalaureat : Option : L l (Humanities) EXHIBITIONS Brasn Cultural Center, Culver City, Los Angeles, CA The Peaceful Warriors (Solo exhibition) and Panelist for l Oth edition of Zumbi, Labasqulat Art Galary, Abidjan, C61e d'Ivoire Ma ville coloree (solo exhibition) Goethe lnstttut, Dakar, S6negal Mo ville coloree (solo exhibition) Centre FGO Barbara, Paris, France Leer Lanu Ge um (group exhibition), part of Tandem Dakar/Paris Goethe lnstttut, Dakar, S6n6gal Debat autour de la Photographie (solo exhibition) Haus der Jugend, Frelburg Im Brelsgau, Germany Mo ville coloree (solo exhibition), part of the Hip Hop festival Jam Down South Casa Afrlca, Las Palmas, Spain Graffrica (group exhibition) African Rim Festival, Tarla, Spain PHOTOAFRICA 201 l (group exhibition) Visages d'Afrlque {group exhibition) Asdar -Association pour la D6valoppamant de la Sant6 an Afrlqua Rurala Espace in vitro, Thionville, France Centro del Arte Moderno, Canary Islands, Spain Morees migrotoires (group exhibition) -Casa Africa project Goethe lntttut, Dakar, Senegal Les /us beaux moments du s ort au Sene al Awarded of the 4tti Edition of Sunu Thiossane annual show for my l l years of work in Arts Administration in Senegal decerned by Sunu Thiossane Selected as one of 25 finalists for 4th PHOTOAFRICA contest, part of the Tarifa African Cinema Festival, Spain Organised by Al Tarab NGO and Andalusian Centre of Photography, Spain PUBLICATIONS EdHlons Vives Vo~ Senegal Musique Senegoloise: participant (release February 2016) 2009 Odober 2016-Presenl July 2016-Present June 2016 January 2016 December 2015 Mars-June 2015 2014 February-March 2014 September 2013 September 2013 September 2012 February 2012 2009 2009 May 2016 Co-founder of ColdBrewTv A Youtube Channel showcasing changemakers, producing independent movies and broadcastings Co-founder of Style and Graffiti A digital platform reuniting Graffiti, murals, Walls and fashion. The purpose is to fine cool swag and a cool model and shot them in front of a graffiti. Sunu Thlossane Youth Development Agency (Bmed In Brookyln New Yorlc) 41h edition production of a short film entitled "Larabilaram: The talibe and me] & annual summ camp Director. Director of Photography & Publicist Untitled Cultural Annual Event, College Universffaire d'ArchHecture de Dakar 1st Edition, AfroPunk Themed event curated by freshman and Sophmore [Exhibition {paint & photography]. Concert and fashion show] Mentor and Sponsor RAW Material/ Independent Curators International OCIJ Dalc.ar, Senegal Curatorial intensive training Auditor and participant Petites Plerres, Dalc.ar, Senegal Selected for the writin worksho Writivism Mix Bar, Togo Curator : lndi o exhibition T olese artist Juvencio Goethe lnstltut, Dakar, Senegal Member of Organizational Committee Official Photographer. PR officer. Journalist: Melodie Mixxx Panos Project Acteurs culturels et acteurs mediatiques: Moteur en Afrique! Member of the editorial committee Project financed by the European Union for 3 years, uniting Senegal, Tunisia, Mali and Niger Pro·ect Mana er and Initiator: hoto ra h contest aimin to reduce social ine uali Tigo Cash • Advertisement campaign Event covera e in the suburbs of Dakar, Photo ra her L'espace Medina, Dakar, Senegal Curator: L'Emotion Ecrite exhibition ra her Mandione La e Kebe Begue Bus (Malboro, Phllp Morris) Photo ra her, Cam ai n tour in Sene al Jam Down South festival (Haus der Jugend, Freiburg Im Breisgau, Germany) Documentation hoto ra hie and written Arte (German TV channel) Appearance in the television programm Metropolis Goethe lnstltut Senegal Tour of Senegal with for photo book project, following the exhibition Les plus beaux moments c s rt au Sene al Casa Africa (Canary Islands, Spain) Photo ra her, translator and uide: Marees mi ratoires ain SUNNAY ProducHons Francophonie Abidjan 2106 (PR for the cultural committee of the Francophonie games during the Dok' Art Biennale 2016) Tastemalc.ers Africa February 2016 July-December 2015 June -July 2015 2013 June -July 2013 2012-present Dakar Ambassador (Co-coordinator, Guide, and Cultural Medium collaborator) Marathon Eiffage Photo ra her and assistant coordinator Ministry of Local Governance, Development and Urban Planning, Dalcar, Senegal Assistant: Department of Communications, Documentation and Public Relations Ministry of Tourism and AvlaHon (MTTA). Dakar, Senegal Photo ra her and PR Officer Africa Plus Size Fashion Week. Dakar, Senegal Official Photo ra her and Director Socas Senegal, Dalcar. Senegal Or anisation of hoto stand for Die Bou Diar cam ai n PeupleSenegalais.nef, lnformaHon slfe Co-founder Photo ra h , content writin , editor culture and art l'M Newspaper, Dalcar, Senegal Photo"oumalist: 1 ima e vaut 1000 mots, Journalist Senegal & Gambia (Goethe lnsitut, Dakar) Cote d'Ivoire Lebas ulat Art Galle , Abld an Germany (Haus der Jugend/Jam Down South, Frelburg) S atn Casa Africa, Cana Islands dram9djibril akagodeye I gadaay Djlbril Drame is a young visual artist, journalist and publicist with over l 0 years of experience. He is known amongst his visual peers as 11Gadaay/GodEye". Djibril, well connected in the artistic world, embarked on many exhibitions and competitions in Europe to share his work through his popular art collection known as "My Colored CHv" where he pushes the envelope of the Senegalese street art and the talents that play a great part such as graffiti artists, hip hop activists and ambassadors of the urban culture. Djibril Drame is among the pioneers and activists in the urban community who have traveled internationally due to his striking talents and captivating photography. While still conducting his own blog "www.peuplesenegalais.net" where he makes time to help expose the dynamics of the young Senegalese change makers locally and abroad about captivating topics we face in the Senegalese daily life and bringing light to social issues. Gadaay hardly entered photography in 2007, shortly after to participate as one of the youngest artistic photographer in the book "Dakar Emor• editions of Vives Voix. Right after this project, he joined the daily popular newspaper L'As where he hosted for one year a section of photographs called "A picture is worth l 000 words." In 201 o. his art is exported internationally, where he represented Senegal in an international event of contemporary art at the GRAFFRICA Fes11val (Las Palmas), in 2011 at the Festfval of the City of Tarlfa (Spain) and so many more. GodEye is among a creative network: of trendsetters and young artists in Senegal, in their own right, whether it be fashion, visual art, communications, dance or entrepreneurship. Down the line, God Eye aims to continue to share his expertise and experience by giving back to his community with the creation of his Visual Art & Communications Academy. He dreams of a bringing the true image of Africa to the wortd one country at a time and creating future ambassadors to continue this legacy. Djlbrll Drame is skilled in communications, mentoring young talents, leadership, management, working with others to achieve a main goal by contributing his experience and knowledge. He has worked with many NGOs and Top Companies in Senegal. Djibril Drame earned his Bachelors in Communications and Journalism with concentration in public relations at the lnstitut des Sciences de !'Information et de la Communication in Senegal. ICI Certificate of Completion THIS CERTIFICATE ACKNOWLEDGES THAT Mr. Djibril Drame HAS SUCCESSFULLY COMPLETED INDEPENDENT CURATORS INTERNATIONAL'S CURATORIAL INTENSWE IN DAKAR WITH RAW MATERIAL COMPANY FROM MAY 30 TO JUNE 5, 2016. c u R A NDEPENDENT 0 .NTERNATIONAL s / Maria del Carmen Carrion Director of Public Programs & Research, ICI Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 charaters) Page 1 Public Art Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Public Art Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1518 characters) 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Public Art Commission 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. (759 characters) Public Art Master Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)_______________________________________________ Date: _____________ Page 4 Public Art Commission Page 1 Public Art Commission Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Radina J. Philyaw Address: 2125Park Blvd Cell Phone: (650)799-3109 _#_ Home / __ Office Phone: (650)322-1052 E-mail: radinaphilyaw@yahoo.com Are you a Palo Alto Resident? _x_ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes _x_ No Are you available and committed to complete the term applied for? x__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes x__ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __x No How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: I met someone from the art commission at the BLM mural painting._____________________________________________________________________________ _ List relevant education, training, experience, certificates of training, licenses, or professional registration: Employment Present or Last Employer: City of Menlo Park (belle Have CDC ) Occupation: Teacher Describe your involvement in community activities, volunteer and civic organizations I actually don’t have any prior involvement. I was touched as well as proud to have this mural in my city. I want to become more involved in helping Palo alto display beautiful works of art. Page 2 Public Art Commission What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? I don’t have experience besides considering myself an artist. I do love art and like I stated earlier, I want to be more involved with my community. 1. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK. The BLM mural was/is such a wonderful experience for me. I went downtown the day the mural was being painted. It was so amazing to see so many different artist out there, creating such beauty for our city. To be honest, I was a little sad that I wasn’t a part of it. That day I introduced myself to almost all of the artist as well as members of the public that were out there, enjoying the experience as much as I was. I met someone that is a part of the art commission. We spoke for a little bit while being surrounded by such a great thing that was taking place. After speaking with the art commission member, I realized that that this would be something I would love to be a part of. 2. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? I would like to see more murals going up in different areas in Palo alto. I would explore the city in efforts to determine which places to choose. I would work with the team to see who would be the best person/artist to do the job. Page 3 Public Art Commission 3. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” The full code is attached. This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: x I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E- mail: Page 4 Public Art Commission Signature: ______Radina J Philyaw__________________________________________________ Date: __7/19/2020___________ Page 1 Public Art Commission Hsinya Shen __ __ __ __ __ __ Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk’s Office: 650-329-2571 Public Art Commission Personal Information - Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Hsinya Shen Address: Cell Phone: Home / 650-888-7052 Office Phone: E-mail: Hsinyashen@yahoo.com Are you a Palo Alto Resident? __ Yes No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? Yes No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Yes No Excluding your principal residence, do you or your spouse own real property in Palo Alto? Yes No How did you learn about the vacancy on the Public Art Commission? Community Group Email from City Clerk Palo Alto Weekly Daily Post City Website Flyer Other: I currently serve on the Public Art Commission. List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 charaters) I have served on the Palo Alto Public Art Commission for the last 3 years and would love the opportunity to continue to contribute based on all I have learned in the last 3 years. Outside of the PAC, I am a life long student and appreciator of the arts. I studied Art History at Wellesley College. I have spent significant time renovating properties and landscape and community building within Palo Alto. I have a demonstrated interest in community betterment and improvement through the arts. Page 2 Public Art Commission Hsinya Shen Employment Present or Last Employer: Akamai Technologies, Inc. Occupation: Attorney Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) I have served on the Palo Alto Public Art Commission for the last 3 years and would love the opportunity to continue to contribute based on all I have learned in the last 3 years. Outside of PAC, having served on the board of a community bank for nearly a decade, I have supported community reinvestment and outreach programs. Also, leveraging my legal background, I have provided community pro bono legal support, including citizenship drive. 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) I believe art can cultivate the human spirit, enhance communication, and promote relationships and community building. While Palo Alto is a suburban city in size and location, it has an international draw and reach. Daily, Palo Alto also draws talents from neighboring towns and brings together a wonderfully diverse population, many of whom welcome the opportunity to get to know the city and connect with the community. As a Palo Alto resident, I have often enjoyed artistic contributions from individual families and businesses. Supplementing these efforts, I believe the Public Art Commission, by investing in different areas of Palo Alto with diverse public art projects, can create spaces and foster opportunities for people to meet, connect, participate, and enrich our community. Page 3 Public Art Commission Hsinya Shen 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1518 characters) One particularly impressionable project for me was by a developer on University Avenue. This developer insisted on spending its 1% public art commitment onsite and ended up proposing a public art sculpture in a dangerous and invisible location, both endangering pedestrians and detracting from the beauty of the building. It is always the individual developer’s choice whether to contribute their 1% public art commitment to the in-lieu pool. If we can show how successful public art projects funded by in-lieu fund improve the city overall, we can hopefully inspire future developers to fulfill their public art commitment with a contribution to the in-lieu fund when their onsite options are limited. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) As a member of the Public Arts Commission, I would like to continue to support projects like California Ave. Master Plan and policies related to important issues like deaccession that will allow us to update public art projects in Palo Alto systematically. Palo Alto is a diverse city by population. Palo Alto Public Art projects reflect its population's diverse prospective, and it would be important to continue to ensure diversity in our public artworks. 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. (759 characters) Public Art Master Plan LINK I have a great appreciation for the Public Art Master Plan. It helps Palo Alto public art team to support an incredibly rich portfolio of short, medium, and long term projects all over Palo Alto. Adhering to the missions and visions outlined in this plan will help the public art team continue to deliver exciting public arts to the city. Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: C/O City of Palo Alto Cell Phone: Home / 650-888-7052 Office Phone: E-mail: Hsinyashen@yahoo.com Signature: (Please type or sign) Hsinya Shen Date: 4/20/20 Page 4 Public Art Commission Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: Page 1 Public Art Commission Harriet Stern 1675 Middlefield Road, Palo Alto 408-893-5199 jacobeatrice@gmail.com X X X X X X BA, Art History, Kenyon College, Gambier, Ohio MA Studies, Modern Art History ,Theory and Criticism, School of the Art Institute of Chicago Diploma, Interior Architecture, Inchbald School of Design, London Internships: Hirshhorn Museum and Sculpture Garden, Washington D.C.; Peggy Guggenheim Collection, Venice, IT Chicago Park District, Archives Department; Art Institute of Chicago, Department of 20th Century Art Teaching Assistant, School of the Art Institute of Chicago Assistant Director, White Pine Gallery, Chicago Corporate Art Consultant, Merrill Chase Galleries, Chicago and Corporate Artworks, Schaumberg, IL Curator, IBEW Local 1245, Vacaville, CA Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1.What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? Page 2 Public Art Commission My last full-time employer was Corporate Artworks now located in Arlington Heights, IL. There I served as an Art Consultant. Since living in Palo Alto I have free-lanced as a curator for the IBEW Local 1245 in Vacaville. In my community I have taken a number of classes at Pacific Art League, Mid-Peninsula Media Center, The Art Center. I attend lectures and music at Stanford, visit arts programming often at all sorts of venues from open studios to the Anderson Collection and everything in between. We attend lots of community and regional theater. I have kids in PAUSD since 2018. I try to stay active and up to date with local and school affairs. For example I have been one of those people writing letters about the airplane noise! Palo Alto Weekly subscriber! My volunteering has been around school for the most part. I try to do one long-term commitment a year coupled with as many one-off assignments possible. To give an example, these are my recent longer term volunteer commitments: Odyssey of the Mind Coach, Elementary Division, The Harbour School, Hong Kong, World Championship Qualifiers, 2017 All Students Matter, Ravenswood School District, Weekly Literacy Volunteer, 2018/19 Palo Alto High School, Weekly Career Counselling Center Volunteer, 2019/2020 A first time visitor comes to Palo Alto City Hall and sees our new Black Lives Matter mural and engages with Cache Me If You Can. They keep walking and see many examples of art around our city. With these public art works Palo Alto signals that creativity and expression are celebrated here. These art works project our community’s values and vision. The Public Art Commission serves a critical role in the direction of this vision—aesthetic and cultural. My specific interest in serving on The Commission is to maintain the public’s trust and the responsible management of our community’s collections, future acquisitions and programming pursuant to our vision. It is my opinion that art should be integral to our city. Palo Alto should support our local artists. We should engage partners to build support for public art and I would like to help create awareness about the program and the collection with community outreach. My experience as a Corporate Art Consultant would serve me well as a Commissioner as I often commissioned artists to create site specific work. I have worked in both commercial and not-for-profit art environments. 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? Page 3 Public Art Commission The Commission has addressed some interesting subjects recently that will be ongoing. One which particularly resonates is that of cultural and racial equality in the field of public art. The BLM mural project was immediate and inclusive, relevant and responsive. How about reaching across the 101 and working with our brothers and sisters in EPA to create something together? Expanding the reach and flexibility of public art interests me. One issue I thought would come up was censoring Cece Carpio’s image of Assata Shakur but was happy to learn there were only letters in support of keeping the mural as it stands. Another issue that interested me was City Council’s recommendation to reduce the Public Art Commission from 7 to 5 Commissioners. What is the net gain in that and is it just a recruitment issue? I would think that the PAC works best with seven diverse points of view to put forth recommendations to City Council, especially as we seek cultural and racial equality in Palo Alto’s future public art goals. Isn’t the river mightier with many tributaries than fewer? As for the BLM mural, which is a huge success and a source of civic pride, it literally would have been difficult to achieve with fewer physical bodies on the Commission. All the Commissioners worked overtime to make that happen seemingly overnight-- quite a remarkable effort at anytime but doubly so given our very unusual world in 2020. World standards of public art and place-making are changing by the minute as we become more culturally and racially aware. It is quite interesting that two years ago our own community renamed two middle schools because some inquisitive students discovered that they are named after some old racists and whose ideologies were incompatible with our current civic vision. This year third-rate Jim Crow-era monuments are being toppled from their plinths and the Washington Redskins are finally being renamed—(when did Stanford drop the name Indians?). The Public Art Commission must always be sensitive that the permanent public art Palo Alto creates today will be judged well in 100 years time. In the same breath, as a student of art history, I revere monuments left by less than perfect societies of the past. How can we not be touched by the magic of Venice or magnificence of Michelangelo’s Pieta or Sistine Chapel? Those sublime Vermeers and the riches of the Rijks Museum, all funded less than ethically if we consider them through or 21st C. lens. These are the challenges those who leave lasting marks, no matter the sector, must consider. It is an exciting time to be in engaged in public art, to change-up the dialogue, to re-direct the discourse. How the world communicates has changed so much since Palo Alto’s Public Art Program was established; it has changed so much in the past six months! Weddings, Baptisms, Funerals by Zoom? For me, the future of public art in Palo Alto reaches a wider community. It speaks to more people— engages across classes, races, ages and genders. Maybe that is through social media and Submittable. Permanent installations need to reflect diversity. Perhaps that means physically going into places we didn’t go before and creating flash events and ride-alongs. Maybe it is making more temporary, ephemeral art that reacts to current events and that taps into the pulse of the moment. No doubt the future of public art is more racially and culturally equitable in acquisitions and programming. The recent BLM mural is a great example of a new wave of public art in PA—responsive, nimble, loads of submissions, exciting and creating lots of interest and civic pride. (This is a great way to increase recruiting for the Public Art Commission as well). I would also like to see Palo Alto teaming with neighboring communities to create art and build friendship and trust. 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” The full code is attached. This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: ________________________________________________________ Date: _____________ Page 4 Public Art Commission 07/21/20 X Yes, I am familiar with the Master Plan. I attended a focus group with the authors and have read the final document. I know that we are about halfway through the ten year plan. The Master Plan has effectively established a professional approach to our Public Art Program and its administration. The goals and timeline are very clearly stated. The Cubberley Artist Studios are included in the Master Plan as a point of discussion. It is my very strong opinion that if Cubberley is used for something else in the future, Palo Alto should maintain subsidised artist studios somewhere within our city limits. Artists enhance diversity of our community. They can't afford to be here without our support. Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 1 of 5 Personal Information Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: ____ Home / ____ Office Phone: E-mail: Are you a Palo Alto Resident? ____ Yes ____ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? ____ Yes ____ No Are you available and committed to complete the term applied for? ____ Yes ____ No California state law and the Ci require appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? ____ Yes ____ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? ___ Yes ___ No How did you learn about this vacancy? ____ Community Group ____ Email from City Clerk ____ Palo Alto Weekly ____ Daily Post ____City Website ____ Flyer Other: List relevant education, training, experience, certificates of training, licenses, or professional registration: DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B 'LIGOIHXLI[IFWMXISJXLI4%%VXW'SQQMWWMSR OEXMIEXEPFSX$LSXQEMPGSQ /EXLIVMRI8EPFSX 0SRKXMQI7XERJSVHVIWMHIRXEGXMZIQIQFIVSJXLI7XERJSVHERH4% GSQQYRMXMIW-EP[E]WRSXMGIXLIEVXMRXLIGSQQYRMX]ERHXLMROEFSYX MX-LEZIFIIRXIEGLMRK/JSVXLIPEWX]IEVW QSWXP]WGMIRGI ERHEQEP[E]WHIPMKLXIH[LIR-JMRHQ]WIPJMRSRISJXLIEVX GPEWWVSSQW-[SYPHPSZIXSFVMRKEPMROFIX[IIR4EPS%PXS WWGLSSP EKITSTYPEXMSRERHEVXMWXWERH4EPS%PXS WZIV]TPIEWERXSYXHSSVERH TYFPMGWTEGIW8IEGLMRKGVIHIRXMEPWMR&MSPSK]4L]WMGWERH'LIQ .YRMTIVS7IVVE&PZH7XERJSVH Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 2 of 5 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -EQGYVVIRXP]WMXXMRKMR1V*IVVIVE WEVXGPEWWEX4EPS%PXS,MKL 7GLSSP-EQWYVVSYRHIHF]]SYRKMRXIVIWXIHERHMRXIVIWXMRKEVXMWXW [LSEVIEPQSWXGSQTPIXIP]EFWSVFIHMRXLI[SVO-XMWMRWTMVMRKXLIMV [SVOMWVIEPP][SVXLPSSOMRKEX,EZMRKXEPOIHXSXLIQEFSYXXLI WXEXYWSJEVXMR4EPS%PXS-EQMRWTMVIHXSETTP]JSVXLI4EPS%PXS %VXW'SQQMWWMSR-LEZIEP[E]WFIIRMRWTMVIHF]XLIEVXTEXXIVRMRK ERHHIWMKRMRWGMIRGIQ]EVIESJXVEMRMRK3ZIV]IEVWSJRSXMGMRK XLIEVXERHHIWMKREVSYRHQIERHMRSXLIVTPEGIWMRXLI97ERH PSSOMRKJSVEVXMR4EPS%PXS-[SYPHIRNS]FIMRKQSVIMRZSPZIH-EQ XLSYKLXJYPVIEH]XSPMWXIRERHPIEVRHMWGYWWERHGSQTVSQMWI-PSZI EVX WEFMPMX]XSQEOITISTPIRSXMGIXLMROPEYKLJIIPERHFIGEPQ 4EPS%PXSLEWEKSSHGSQTVILIRWMZITPERJSVEVXMRTPEGI2S[MX W XMQIXSMQTPIQIRXERHQEOI4EPS%PXSETPEGIXLEX W[SVXLPSSOMRKEX JSVQSVIXLERMX WIRZMVSRQIRXEPEXXVMFYXIW4EPS%PXS[SYPHFIRIJMX JVSQQSVITYFPMGEVXERHGSYPHIEWMP]FIEREVXPIEHIVERH-[SYPH PSZIXSFVMRKQ]JIEVPIWWWX]PIERHWXVSRKEFMPMX]XSJSVKIGSRWIRWYW XSLIPTQEOIXLMWLETTIR ,EZMRKVEMWIHX[SGLMPHVIRVIWMHMRKMR7XERJSVHERHWGLSSPIHMR4EPS %PXS-TEVXMGMTEXIMRXLIWGLSSPWXLVSYKLWGMIRGIJEMVWWYFWXMXYXI XIEGLMRKERH'LSSWMRK7GLSSP2EQIW'SQQMXXII-TEVXMGMTEXIMR4EPS %PXS0MXXPI0IEKYI GSEGLMRK'LEPPIRKIV7TIGMEP2IIHW8IEQ ERH7TIGMEP 3P]QTMGW XVEGOGSEGL -TEVXMGMTEXIMRXLI0IEKYISJ;SQIR:SXIVW LSYWMRKERHXVERWTSVXEXMSRGSQQMXXIIVIKMWXIVMRKLMKLWGLSSPZSXIVW ERHGSQQYRMX]IHYGEXMSREFSYXFEPPSXMRMXMEXMZIW 3YVJEQMP]MRER EGXMZIYWIVSJ4EPS%PXS WTEVOW-EPWSFMOIEPPEVSYRH4EPS%PXSXS VIEGLQ]WYFWXMXYXIXIEGLMRKKMKWWS-JIIPZIV]GSRRIGXIHXSXLI TL]WMGEPIRZMVSRQIRXEW[IPPEWXSXLIWGLSSPEKIHTSTYPEXMSR 4EPS%PXS9RMJMIH7GLSSP(MWXVMGX XIEGLIV Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 3 of 5 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -JSPPS[IHXLIMWWYIWEVSYRHXLIVIHIWMKRSJ'EPMJSVRME%ZIRYIERHXLI EVXSR%PQEERHSR9RMZIVWMX]MRXLIRI[WTETIVWERHMRTIVWSR- HIJMRMXIP]LEZISTMRMSRWEVSYRHXLSWIMWWYIWTEVXMGYPEVP]EFSYXXLI GSWXWSYVGMRKTIVQERIRGIERHTPEGIQIRXSJEVX-EPWSXLMROEFSYX XLITSWWMFMPMXMIWJSV4EPS%PXSXSFIETPEGI[LIVI]SYRKTISTPIEVI MRWTMVIHERHF]XLIEVXEVSYRHXLIQPIEVRJVSQMXERHGSQIXSI\TIGX XLEXXLIMVPMJIWLSYPHFIWYVVSYRHIHF]ERHIRVMGLIHF]EVX-PSZIXLI IRZMVSRQIRXEPEVXXLEXXLIGSQQMWWMSRMWTYVWYMRKMRXLI&E]PERHW-X [SYPHRSXLEZISGGYVVIHXSQIXSZMI[XLEXEWEVX MXMWEZIV] WMKRMJMGERXTVSNIGX 8LMWUYIWXMSRMWSFWGYVIHERHEPP-GERWIIMX,S[[SYPH]SYWYKKIWX EGGSQTPMWLMRKXLMW# ,S[HS[IKIXSYVXEPIRXIH]SYRKWXIVWMRZSPZIHMRERHIRNS]MRKXLIEVX EVSYRHXLIQ#0SSOMRKEXI\EQTPIWSJTYFPMGEVXJVSQEVSYRHXLI97 XLIVI[IVIZIV]RMGII\EQTPIWSJQYVEPEVXERHGVSWW[EPOEVX[LMGL VIEPP]PMZIRYTGMX]WGETIW0IZIVEKMRKXLIXEPIRXMRSYXGSQQYRMX] GVSWW[EPOEVXXLEXMRGVIEWIWTYFPMGWEJIX]ERHKMZIWYWIVWEVIEPWIRWI SJTPEGIGERIEWMP]FITVSHYGIH7XVIIXEVXMREPPSJMXWJSVQW [SYPHQEOIWIGXMSRWSJ4EPS%PXSQSVIPMZIP])ZIRWSQISJ4EPS W FIEYXMJYPXVIIPMRIHWXVIIXW[SYPHLSWXGEVIJYPP]GLSWIREVXXLEXMW GSQQYRMX]NYVMIHERHVIJPIGXMZISJXLIIRZMVSRQIRX ,EZMRKEWTEGI[LIVIEVXMWHMWTPE]IHZIV]TYFPMGP]GSYPHWLS[GEWILMKL WGLSSPSV7XERJSVHEVXERHGSYPHXYVRSZIV[IIOP]SVQSRXLP]8S MRGVIEWII\TSWYVIXSEVXXLIWII\LMFMXWWLSYPHFITPEGIH[LIVIQSWX TISTPI[SYPHWIIXLIQEXQER] PSGEXMSRWEVSYRHXLIGMX]ERHMR XLIRIMKLFSVLSSHW;IEXLIVVIWMWXERXHMWTPE]GEWIW[MXLVSXEXMRKLMKL WGLSSPEVX[SYPHTVSZMHIVIWMHIRXW[MXLERIMKLFSVLSSHHIWXMREXMSRERH MRGVIEWIXLIEQSYRXSJJSSXXVEJJMGMRSYVRIMKLFSVLSSHW ,S[HS[IKIXEVXXLEXMRXIVEGXW[MXLSYVIRZMVSRQIRX#-PSZIHVIEHMRK EFSYXXLITVSNIGXXSMRGVIEWIFYVVS[MRKS[PRIWXMRKJSVEKMRKMRXLI FE]PERHW-[SYPHJSGYWSRTYFPMGM^MRKXLIWITVSNIGX Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 4 of 5 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -NYWXVIEHEPQSWXEPPSJXLIHSGYQIRXERHJSYRHMXXSFIGSQTPIXIERH GSQTVILIRWMZI2MGINSFTVSHYGMRKXLMW[IPP[VMXXIRHSGYQIRX2S[MX MWXMQIXSMQTPIQIRXXLIWIVIGSQQIRHEXMSRWERH- HPSZIXSFIMRZSPZIH Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 5 of 5 Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, This consent form will not be redacted and will be attached The full code can be read here: Read the code, and check only ONE option below: _ I give permission for the City of Palo Alto Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: ____ Home / ____ Office Phone: ___________________________________________________ Email: ____________________________________________ The phone number / address can be nonpublic and different than the address collected on page one. (Optional) Additional Attachment(s) If you would like to submit a resume, work sample, etc. along with your DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B .YRMTIVS7IVVE&PZH7XERJSVH OEXMIEXEPFSX$LSXQEMPGSQ Page 1 Public Art Commission __ __ __ __ __ __ Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk’s Office: 650-329-2571 Public Art Commission Personal Information - Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Nia Taylor Address: Cell Phone: Home / Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? Yes No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Yes No Excluding your principal residence, do you or your spouse own real property in Palo Alto? Yes No How did you learn about the vacancy on the Public Art Commission? Community Group Email from City Clerk Palo Alto Weekly Daily Post City Website Flyer Other: current commissioner List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 charaters) Current Public Art Commissioner (Since May 2014) Art Educator MA in Visual Arts Administration Minor in Art History Page 2 Public Art Commission Employment Present or Last Employer: Congregation Sherith Israel Occupation: Membership & Development Manager Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Commissioner, City of Palo Alto Public Art Commission, May 2014 - present Volunteer, Friends of Lafayette Park, 2014 - present. Once a month I clean and beautify Lafayette Park in San Francicso. The park is 3 blocks from my current place of employment. Volunteer, Jewish Family and Children’s Services, 2010 - present. I help the organization package and deliver food packages for homebound seniors during Jewish holidays. 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) With a background in visual arts administration, art education, and art history, I love creating, talking, and viewing art in all its forms. I am a firm believer that art, as much as possible, should free and accessible to all people, hence the reason I initially decided to apply for a position on the Public Art Commission. Since my tenure, I have thoroughly enjoyed working with my fellow commissioners, public art advisors, architects, and community members, to procure, and protect, public art that will beautify and enhance the City of Palo Alto. Page 3 Public Art Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1518 characters) Although I enjoy all aspects of being on the Public Art Commission, I have become particulary interested in our Percent for Art in Private Development Program. I especially like that it encourages developers to a) support artists and the visual arts, and b) promote art as a cultutral resource for the community. Since joining the commission in 2014, we have supported a number of Percent for Art in Private Development projects, many of which are currently on public view. If given the opportunity to continue for another term, I hope that I will be able to inspire more private developers to seek and display public art that is thought provoking and positively invites public interaction. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Goal #1: Develop a marketing campaign (e.g. bus and newspaper ads, banners, poster, etc.) that would promote and enhance the visibility of our wonderful collection. Ways to meet goal: Contact local media outlets (Weekly, PA Daily Post, blogs) and ask if they would publicize some of the works in our collection and/or enable us to place a low-cost and/or free ad promoting the collection. Goal #2: Enhance California and University Avenue by adding art inside empty store fronts and/or art onto contrusction barriers. Ways to meet goal: Ask artists (local and non-local, professional and novice) to submit 2-D works of art which we could hang inside empty storefronts and/or onto construction barriers. (Fun fact: I had the pleasure of being on a panel to choose art for a contrustion barrier behind California Avenue. It was a huge success.) Page 4 Public Art Commission 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. (759 characters) Public Art Master Plan LINK I was on the commission when the Master Plan was being developed. I have also had the great pleasure of being on the commission to implement many of the suggested recommendations. I hope that I will have the opportunity to continue turning suggested recommendations into actions should I be chosen to complete another term on the PAC. Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: Home / E-mail: Office Phone: Signature: (Please type or sign) Date: 3.31.2020 1 of 1 TO: HONORABLE CITY COUNCIL FROM: BETH MINOR, CITY CLERK DATE: AUGUST 3, 2020 SUBJECT: AGENDA ITEM NUMBER 9- Selection of Applicants to Interview for one Position on the Human Relations Commission and two Positions on the Public Art Commission The packet of applications included with this Staff Report contained incomplete and duplicate applications. In addition, the Staff Report lists Shannon Rose McEntee as a candidate for the Public Art Commission, but she withdrew her application prior to the deadline. Please see attached for the corrected list of candidates and applications. _______________________ Beth Minor City Clerk 9 DocuSign Envelope ID: 055A5184-C7A8-43E1-A1D2-8B1A9C8596E8 Boards and Commission Applications Spring/Summer 2020 Recruitment Human Relations Commission and Public Art Commission Human Relations Commission: 1.Nilofer Chollampat 2.Sunita de Tourreil 3.Sofia Fojas 4.Curt Kinsky 5.David Villaseca Morales 6.Paula Rugg 7.Lestina Trainor Public Art Commission: 1.Djibril Drame 2.Marilyn Gottlieb-Roberts 3.Radina Philyaw 4.Hsinya Shen (Incumbent) 5.Harriet Stern 6.Katherine Talbot 7.Nia Taylor (Incumbent) +XPDQ5HODWLRQV&RPPLVVLRQ Personal Information ±1RWH 7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW SP Name: Address: Cell Phone: __Home /__Office Phone: E-mail: Are you a Palo Alto Resident?__ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for?__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto?__ Yes __ No How did you Oearn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: FKDUDFWHUV Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Nilofer Chollampat 3708 Starr King Circle 650 468-1306 6508568686 nchollampat@gmail.com ✔ I currently work in a health tech start up where we are looking into ways to diversify and create a more inclusive a people to recruit from. In my time in undergrad and graduate school I spent a lot of extracurricular time working with organizations related to racial and social justice. I have also worked in non-profit organizations that work with government committees and commissions Nilofer Chollampat Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Human Relations Commission Evidation Health Clinical Research Specialist Through my full time job, I've been able to participate in a wide variety of volunteer activities related from creating toiletry packs for homeless woman to food banks. Also during election cycles I enjoy phone banking for candidates. The concerns of the Human Relations Commission are things I think about in my personal and work life every day. It comes with a heavy burden but it's important to look at things with a critical lens and create space and opportunity for people no matter their identity. I find that government can be a challenging place but it's where change can happen. Nilofer Chollampat 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU:LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Human Relations Commission Recently, the commission reviewed the "8 Can't Wait" Policies with the Police Chief. It's interesting because it shows that the City of Palo Alto is conscious of current events and how to implement or work it into our own policies. It shows that the city is willing and able to discus topics that could have lasting impacts One specific goal would be to work on healthcare literacy. My background is working on healthcare policy and given our current events it's important that people are aware of what free services are available to them and where they can receive it. Healthcare is as much a part of Human Relations as is transportation and housing. If the city is providing free COVID or any other testing, it should be disseminated and targeted to everyone with efficiency. I think the city does a great job of this already but we could take it further. Nilofer Chollampat 4. Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. FKDUDFWHUV Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __Home /__Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ ____________________________________Date: _____________ Page 4 Human Relations Commission 7/21/20 I have worked on a needs assessment in previous jobs, but that is the extent of my experience with all three documents Nilofer Chollampat +XPDQ5HODWLRQV&RPPLVVLRQ Personal Information ±1RWH 7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW SP Name: Address: Cell Phone: __Home / __Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for?__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto?__ Yes __ No How did you Oearn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: FKDUDFWHUV Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF SUNITA DE TOURREIL 708 RAMONA STREET, PALO ALTO, CA 94301 650-796-5287 sunita@chocolatedividends.org ✔ PALO ALTO CORONAVIRUS REPORT MASTERS of SCIENCE, MOLECULAR BIOLOGY AND HUMAN GENETICS Worked at UCSF with dying patients with Creutzfeldt Jakob disease, collaborating with nurses, orderlies, local businesses, doctors, scientists all working together to develop a diagnostic test. Founded and built a business that built diverse community in Palo Alto between 2010 and 2018 (The Chocolate Garage) and addressed bringing transparency, accountability and activism to the cocoa supply chain. Also lead luxury educational trips to the global south, to educate and open minds towards other cultures. Single mom to two kids going to school in Palo Alto. SUNITA DE TOURREIL Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Human Relations Commission Self-employed, HAPPY CHOCOLATE EXPERIENCES LLC ENTREPRENEUR Volunteer at Addison Elementary School with Project Cornerstone (social emotional learning) and other activities at Addison and Girls Middle School. Started attending City Hall Meetings in early 2020. Spoke at one, inquiring about a police incident that I observed. Trained as a CASA (Court Appointed Special Advocate) in 2005-2006. Multiple community events through my social enterprise, around educating around supply chains, around using your purchasing choices to bring about change in the world. I am open, curious, smart and I desire seeing stronger more resilient and inclusive communities, where we move from love and not from fear. I have excellent interpersonal skills, I am used to working with different parties, with different backgrounds and goals. I speak English, French and Spanish, and bring a cultural understanding with this language fluency. I feel I bring different cultural experiences and practices, having traveled a great deal in both the global south, as well as the global north. I give people the benefit of the doubt, and believe that humans are decent and are doing the best they can with the tools that they have. I think all these skills are needed for the Human Relations Commission, and I would dedicate myself to listening to more of the community I would be serving. I want to see a Palo Alto that helps everyone feel like they are welcome, they belong and are safe. SUNITA DE TOURREIL 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU:LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Human Relations Commission I am interested in seeing more transparency and accountability around diversity, so that we include more voices, and more compassion in our city policies. I am interested in this as a biracial cisgender woman raising two white identified kids, as a single mom in a culture of white male supremacy. My white kids voices will likely be more listened to, and heard, than their black and brown friends and family members. In addition to raising them to understand their white privilege and then be moved to use that privilege to help protect and give voices to those who aren't being listened to, I want to take part in our local community, as a minority biracial resident of Palo Alto. I have benefited from much of the privilege that is bestowed upon affluent white families, having immigrant parents with graduate degrees and growing up in Canada and getting a graduate degree. I want to be aware of this privilege and use my skills to listen to those who have less voice. I also want to use my immigrant experience to bring a fresh look at our cultural short sightedness and broaden the conversations we are having and the solutions we are considering. I want to ensure that the recent policies around diversity and improvements to the policing systems in Palo Alto continue to be evaluated and improved upon. I think continuing to invite community members and various experts in this area to speak on panels, and answer HRC members questions, to dig deeply into these issues, and come up with creative and compassionate solutions, is one way to more deeply understand the legacies of our past, and find new ways to build better systems for the future. I think engagement with organizations already started by our local youth, and deep listening and learning from our next generation of leaders, is critical. Engaging them to help us achieve our goals, and guide our solutions. SUNITA DE TOURREIL 4. Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. FKDUDFWHUV Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __Home / __Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ ____________________________________Date: _____________ Page 4 Human Relations Commission July 9, 2020 I do not have experience with any of these documents. SUNITA DE TOURREIL +XPDQ5HODWLRQV&RPPLVVLRQ Personal Information ±1RWH 7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW SP Name: Address: Cell Phone: __Home /__Office Phone: E-mail: Are you a Palo Alto Resident?__ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for?__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto?__ Yes __ No How did you Oearn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: FKDUDFWHUV Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Sofia Fojas 3371 Park Blvd, Palo Alto, CA 94306 (650)339-5596 slfojas@gmail.com ✔ ✔ I am an arts administrator for the Santa Clara County Office of Education and have teaching credential in Music as well as a Master's of Educational Leadership and an administrative credential. I am a 26-year veteran in public education and have worked in schools serving students of color living in poverty. I have been involved in racial equity work in the arts both at the local level, state level in my work with the California Alliance for Arts Education and at the national level on the Racial Equity Committee for the National Guild for Community Arts. Sofia Fojas Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Human Relations Commission Santa Clara County Office of Education Arts Coordinator My work in public education has always been focused on students needing the most supports. I began as a music teacher in Stockton and then took a job in San Jose where I taught in arts programs funded under the Desegregation order in the 1970s. I have been a champion of arts and culture in my tenure as a teacher and served on the Bay Section Board of the California Music Educators' Association (CMEA)and the State chapter of CMEA as the Multicultural Representative, connecting teachers to cultural arts organizations in professional development sessions toward expanding what the arts could be in reaching students and families of color. In 2008, I was in the first class of First Act Silicon Valley's Multicultural Arts Leadership Initiative, a training program for young arts leaders. I served on the board of the California Alliance for Arts Education for two years in 2017 and am a member of the Racial Equity Committee on the board of the National Guild for Community Arts Education. In my current position, I and my new team will be delivering professional learning through a strong equity lens in supporting districts using a model of shared leadership between higher education, K-12 and arts organizations in the county. As a 26-year veteran in public education and a child of immigrants, I first became aware of the work of the Human Rights Commission in my work in San Francisco in 2016. I had several opportunities to work with members of the SF HRC staff around the development of equitable arts experiences for students in the Bayview. I have always been civic minded and have been aware of my acquired privilege through education and my influence and positional authority in the arena of arts education locally, at the state level and nationally. In my work around arts equity and particularly in these times of racial disparity, the pandemic and economic instability, I see the inequities played out in education as a symptom of a larger systemic imbalance. My interests in serving families have extended beyond education to address issues in housing, health access, economic opportunity and crime and social justice issues. The Human Rights Commission is an important vehicle for addressing these issues in Palo Alto and I want to bring my experiences and skillset in education as a voice on the Human Rights Commission. Sofia Fojas 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU:LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Human Relations Commission I have been particularly interested in the reexamination of police services in our cities in light of the death of George Floyd as it relates to '8 Can't Wait'. As an educator, I have seen the increased presence of the police on our school campuses, especially apparent in schools where students of color are present. Palo Alto has always been a city in a bubble but I have been made aware of the unequal treatment of people of color in our city. I am a proud member of the Ventura neighborhood and am very much aware of its poor reputation even as it is the neighborhood founded on redlining and segregation. I am interested in looking at the role of the police in our city and finding ways to disrupt the racialized outcomes that people of color and those living in poverty encounter in their interactions with police. The specific goals I would like to address on the Human Rights Commission are: '8 Can't Wait' and reexamining the role of the police; homelessness and the unhoused; and youth development and diversity in moving away from a culture of excellence and competition, towards the development of empathy and social emotional learning. I imagine engaging the arts organizations and funders in this region to develop programs for community members to have conversations with each other through arts activities and experiences. We have Stanford University in our midst to bring in as a partner in this work as well as a arts and culture organizations in the county who would gladly pivot towards civic engagement while we are sheltering in place. The schools could also be a partner in this work around youth development and well-rounded education and the building of empathy through the arts to prepare for a 21st century world that is sure to look different than what we know to exist now. Sofia Fojas 4. Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. FKDUDFWHUV Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __Home / __Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ ____________________________________Date: _____________ Page 4 Human Relations Commission 07/21/2020 While I have heard about a couple of these documents, I have no direct experience with them. Sofia Fojas +XPDQ5HODWLRQV&RPPLVVLRQ Personal Information ±1RWH 7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW SP Name: Address: Cell Phone: __Home /__Office Phone: E-mail: Are you a Palo Alto Resident?__ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for?__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto?__ Yes __ No How did you Oearn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: FKDUDFWHUV Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Curt B. Kinsky 1675 Middlefield Road, Palo Alto, CA 94301 4088939273 curt.b.kinsky@outlook.com ✔ 30 years with Ernst & Young, a global professional services firm 21 years as a Principal leading multi-racial, gender diverse teams in delivering international tax services 17 years abroad (Amsterdam, Milan, London, Paris, Shanghai, and Hong Kong) with exposure to multi-cultural teams and issues Bachelor of Arts (1985; double major) in English and History from Kenyon College Master of Management (1996)in Marketing from Kellogg Graduate School of Management of Northwestern University Master of Arts (degree not yet conferred; 1987)in International Relations from The University of Chicago INSEAD Executive Education Curt B. Kinsky Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Human Relations Commission Ersnt & Young LLP Principal, International Tax Services I have been an active volunteer with All Star Project Development School for Youth in San Francisco. Here we bring forward underprivileged high school student and provide them opportunities for workplace advancement they would not otherwise have. Honestly, my Palo Alto community involvement to date has been minimal to nonexistent. I view this application to the HRC as a first step towards engagement. NOW means now. I have to get involved; contribute to my community. After three decades of professional services experience at the highest levels across the globe, I know I have much to offer. In my business career, I have led teams across the globe with members from diverse ethnic, cultural, socio-economic, and gender characteristics. This has given me insight into the fundamental societal issues of the day. Given the extraordinary tumult we are living through, I believe my experience at finding common ground amongst diverse team members will prove invaluable to the Commission. To me, at this point in time, the bottom line is very simple: NOW means now - I have to find a way to be involved and to make a contribution. I honestly believe my proven ability to team and find common solutions amongst diverse members is accretive to the important work of the commission. Curt B. Kinsky 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU:LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Human Relations Commission 8 Can't Wait The July meeting of the Commission was an important public forum discussion regarding policing in our community. I believe the implementation of 8 Can't Wait is extremely important and needs to be done now. However, this cannot be the only steps taken to reform our approach towards policing. Many are skeptical of these reforms citing they are too superficial to have any meaningful impact. While this premise remains to be proven, it none the less demonstrates the need to do more and think/act deeper. However, I believe we cannot go from a standing start to a full sprint without taking a few initial accelerating steps. We need to create positive momentum by putting in place the 8 reforms and using this as a platform to evolve further. We cannot afford the time to ignore these relatively straightforward recommendations at the expense of laborious discourse on deeper changes. Goal #1: Civil community discourse. If we are to accomplish any fundamental changes in our society, they must be premised on coalescing people with diverse views. We have to improve our capability to listen. I would accomplish this goal by leveraging my team building capabilities and cross cultural acumen to build positive consensus around issues. Goal #2: Diversification without coercion Palo Alto has diversity in its population and thinking. However, from the outside, it appears a Wonder Bread society. We have to find ways to bring forward the diversity resident in our society. In doing so, we need also to adhere to goal #1 and not force people into positions just to demonstrate diversity. There has been some internal conflict on the HRC and this has lead to a lack of confidence in the workings of the Commission. Curt B. Kinsky 4. Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. FKDUDFWHUV Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __Home / __Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ ____________________________________Date: _____________ Page 4 Human Relations Commission I do not have experience with these documents. However, in my three decades of work in professional services, I have operated under strict governance guidelines (some of which I have helped define/write) and thus am comfortable working in environments such as those described in the three links above. Curt B. Kinsky 4IVWSREP-RJSVQEXMSR 2EQI %HHVIWW 'IPP4LSRI CC ,SQICC 3JJMGI4LSRI )QEMP %VI]SYE4EPS%PXS6IWMHIRX#CC=IWCC2S (S]SYLEZIER]VIPEXMZIWSVQIQFIVWSJ]SYVLSYWILSPH[LSEVIIQTPS]IHF]XLI'MX]SJ4EPS%PXS[LS EVIGYVVIRXP]WIVZMRKSRXLI'MX]'SYRGMPSV[LSEVI'SQQMWWMSRIVWSV&SEVH1IQFIVW#CC=IWCC2S %VI]SYEZEMPEFPIERHGSQQMXXIHXSGSQTPIXIXLIXIVQETTPMIHJSV#CC=IWCC2S 'EPMJSVRMEWXEXIPE[VIUYMVIWETTSMRXIHFSEVHERHGSQQMWWMSRQIQFIVWXSJMPIEHIXEMPIHHMWGPSWYVISJ XLIMVJMRERGMEPMRXIVIWXW*EMV4SPMXMGEP4VEGXMGIW'SQQMWWMSR'SRJPMGXSJ-RXIVIWX*SVQ (S]SYLEZIERMRZIWXQIRXMRSVHS]SYWIVZIEWERSJJMGIVSVHMVIGXSV SJEGSQTER]HSMRKFYWMRIWWMR4EPS%PXS[LMGL]SYFIPMIZIMWPMOIP]XS IRKEKIMRFYWMRIWW[MXLXLI'MX] TVSZMHITVSHYGXWSVWIVZMGIWJSV'MX]TVSNIGXWSV FIEJJIGXIHF]HIGMWMSRWSJXLIFSEVHSVGSQQMWWMSR]SYEVIETTP]MRKJSV#CC=IWCC2S )\GPYHMRK]SYVTVMRGMTEPVIWMHIRGIHS]SYS[RVIEPTVSTIVX]MR4EPS%PXS#CC=IWCC2S ,S[HMH]SYIEVREFSYXXLIZEGERG]SRXLI,YQER6IPEXMSRW'SQQMWWMSR# CC'SQQYRMX]+VSYT CC)QEMPJVSQ'MX]'PIVO CC4EPS%PXS;IIOP] CC(EMP]4SWX CC'MX];IFWMXI CC*P]IV 3XLIV CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 0MWX VIPIZERX IHYGEXMSR XVEMRMRK I\TIVMIRGI GIVXMJMGEXIW SJXVEMRMRK PMGIRWIW SV TVSJIWWMSREP VIKMWXVEXMSR 4EKI ,YQER6IPEXMSRW'SQQMWWMSR(%:-( :-00%7)'% 136%0)7 HEZMH$HEZMHZMPPEWIGEGSQ +PSFEP ,IEH SJ '< 1EVOIXMRK 7EPIW 3VEGPI *MRERGMEP 7IVZMGIW +VSYT *SV ]IEVW - LEZI FYMPX QYPXMHMWGMTPMREV] XIEQW ERH FYWMRIWW MR GSYRXVMIW 97% )1)%0%8%1 %4%' f JSV 3VEGPI %GGIRXYVI &&:% 'SGE'SPE *ERXE 0:1, 47% 4IYKISX 'MXVSÌR ERH 7ERXERHIV &7 &YWWMRIWW 0E[ -RXIVREXMSREP (MTPSQE JVSQ 9'&IVOIPI] )YVSTIER 0E[]IV &SVR MR 7TEMR JEXLIV SJ HEYKLXIVW (%:-( :-00%7)'% 136%0)7 )QTPS]QIRX 4VIWIRXSV0EWX)QTPS]IV 3GGYTEXMSR (IWGVMFI]SYVMRZSPZIQIRXMRGSQQYRMX]EGXMZMXMIWZSPYRXIIVERHGMZMGSVKERM^EXMSRW ;LEXMWMXEFSYXXLI,YQER6IPEXMSRW'SQQMWWMSRXLEXMWGSQTEXMFPI[MXL]SYVI\TIVMIRGIERH SJWTIGMJMGMRXIVIWXXS]SYERH[L]# 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 3VEGPI 8IGLRSPSK]SR 'YWXSQIV )\TIVMIRGI(MKMXEP &EROMRK -RZSPZIH MR VIWIVGL KVSYT SR KIRHIV WTIGMPM^IH SR [SQIR IRXVITVIRIYV 4YVWYMRK 4L( [MXL TYFPMGEXMSRW SR KIRHIV ERH IRXVITVIRIYVWLMT *SVQIV %HZMWSV SJ '13 'SYRGMP WYTTSVXMRK FYWMRIWW TVSKVIWW 3R E TIVWSREP WMHI - EQ ER MRQQMKVERX MR 4EPS %PXS GSQMRK JVSQ 7TEMR ERH XV]MRK XS WYTTSVX ERH KMZI FEGO XS XLI GSQQYRMX] 3RXLITVSJIWWMSREPWMHI-EQJSGYWIHSRLYQERM^MRKXLIXIGLRSPSK]EWE [E] XS MRGPYHI IZIV]FSH] 3R E WGMIRXMJMG VIWIEVGL WMHI - EQ JSGYWIH SR WYTTSVXMRK [SQIR IRXVITVIRIYVW [SVPH[MHI ERH SR E PSGEP FEWMW HYI XS XLIMV PS[IV TVIWIRGI MR QER] GSYRXVMIW (%:-( :-00%7)'% 136%0)7 4PIEWIHIWGVMFIERMWWYIXLEXVIGIRXP]GEQIFIJSVIXLI'SQQMWWMSRXLEXMWSJTEVXMGYPEVMRXIVIWX XS]SYERHHIWGVMFI[L]]SYEVIMRXIVIWXIHMRMX-J]SYLEZIRIZIVFIIRXSE'SQQMWWMSRQIIXMRK ]SYGERZMI[EREVGLMZI 0-2/ -JETTSMRXIH[LEXWTIGMJMGKSEPW[SYPH]SYPMOIXSWIIXLI,YQER6IPEXMSRW'SQQMWWMSR EGLMIZIERH[L]#,S[[SYPH]SYWYKKIWXEGGSQTPMWLMRKXLMW# 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 6IPIZERGI SJ GMZMG IRKEKIQIRX SJ JEQMPMIW MR GLMPHGEVI TVSKVEQ SR XLI 3GXSFIV XL WIWWMSR &IEGYWI SJ XLI RIIH ETTSMRXIH XS EJJSVHEFPI GLMPHGEVI EW [IPP EW MRZSPZMRK JEQMPMIW -RXIVIWXMRK XLI FIRGLQEVOMRK MR XLMW GEWI 4MXXWFYVKL XS IRLERGI XLI PMJI UYEPMX] SJ 4EPS %PXS GMXM^IRW -RXIKVEXMSR SJ MRQMKVERX JEQMPMIW EGVSWW KIRHIV VEGI SV EKI ,YQERM^MRK XIGLRSPSK] EW E [E] XS GSRRIGX XLI GSQQYRMX] *SWXIV IRXVITVIRIYVW RS QEXXIV XLI KIRHIV 8LIWI KSEPW [SYPH FI YWIJYP XS MRXIKVEXI XLI GSQQYRMX] EW [IPP EW MRGVIEWI XLI UYEPMX] SJ PMZMRK SJ %00 4EPS %PXS GMXM^IRW (%:-( :-00%7)'% 136%0)7 ,YQER6IPEXMSRW'SQQMWWMSR1IQFIVW[SVO[MXLXLIHSGYQIRXWPMWXIHFIPS[-J]SYLEZI I\TIVMIRGI[MXLER]SJXLIWIHSGYQIRXWTPIEWIHIWGVMFIXLEXI\TIVMIRGI)\TIVMIRGI[MXLXLIWI HSGYQIRXWMWRSXVIUYMVIHJSVWIPIGXMSR ,YQER7IVZMGIW2IIHW%WWIWWQIRX 0-2/ 1YRM'SHI §1ERHEXSV]6IWTSRWI4VSKVEQ 0-2/ 'SQQYRMX]7IVZMGIW)PIQIRXSJXLI'SQTVILIRWMZI4PER 0-2/ 'SRWIRXXS4YFPMWL4IVWSREP-RJSVQEXMSRSRXLI'MX]SJ4EPS%PXS;IFWMXI 'EPMJSVRME+SZIVRQIRX'SHI7IGXMSRWXEXIWMRTEVX©2SWXEXISVPSGEPEKIRG]WLEPPTSWXXLI LSQI EHHVIWW SV XIPITLSRI RYQFIV SJ ER] IPIGXIH SV ETTSMRXIH SJJMGMEP SR XLI -RXIVRIX [MXLSYX JMVWX SFXEMRMRKXLI [VMXXIRTIVQMWWMSRSJ XLEXMRHMZMHYEPª8LMWGSRWIRXJSVQ[MPPRSX FIVIHEGXIHERH[MPPFI EXXEGLIHXSXLI%TTPMGEXMSRERHTSWXIHXSXLI'MX]¬W[IFWMXI 8LIJYPPGSHIGERFIVIEHLIVI 0-2/ 6IEHXLIGSHIERHGLIGOSRP]32)STXMSRFIPS[ -KMZITIVQMWWMSRJSVXLI'MX]SJ4EPS%PXSXSTSWXXSXLI'MX]¬W[IFWMXIXLIEXXEGLIH&SEVHERH 'SQQMWWMSR%TTPMGEXMSRMRXEGX-LEZIVIEHERHYRHIVWXERHQ]VMKLXWYRHIV+SZIVRQIRX'SHI 7IGXMSR-QE]VIZSOIXLMWTIVQMWWMSREXER]XMQIF]TVSZMHMRK[VMXXIRRSXMGIXSXLI4EPS %PXS'MX]'PIVO 36 -VIUYIWXXLEXXLI'MX]SJ4EPS%PXSVIHEGXQ]LSQIEHHVIWWTLSRIRYQFIVWERHIQEMPEHHVIWW JVSQXLIEXXEGLIH&SEVHERH'SQQMWWMSR%TTPMGEXMSRTVMSVXSTSWXMRKXSXLI'MX]¬W[IFWMXI-EQ TVSZMHMRKXLIJSPPS[MRKEPXIVREXIMRJSVQEXMSRERHVIUYIWXXLEXXLI]YWIXLIJSPPS[MRKGSRXEGX MRJSVQEXMSRMRWXIEH %HHVIWW 'IPP4LSRI CC,SQICC3JJMGI4LSRI )QEMP 7MKREXYVI CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC (EXI CCCCCCCCCCCCC 4EKI ,YQER6IPEXMSRW'SQQMWWMSR 1MHXS[R 4EPS %PXS HEZMH$HEZMHZMPPEWIGEGSQ (%:-( :-00%7)'% 136%0)7 +XPDQ5HODWLRQV&RPPLVVLRQ Personal Information ±1RWH 7KH+5&UHJXODUO\PHHWVWKHVHFRQG7KXUVGD\RIWKHPRQWKDW SP Name: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto? __ Yes __ No How did you Oearn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: FKDUDFWHUV Page 1 Human Relations Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Paula Rugg Bonnie94306@yahoo.com ✔ BA in Education MA in Education Administration. Public School Adminstration - 23 years. CERT - Fremont and Palo Alto Paula Rugg Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Human Relations Commission Fremont Unified School District School Principal I am a Board Member and Operations Lead for the Democratic Volunteer Center. My main tasks are encouraging volunteers to engage in the democratic process, register voters, walk precincts, and host speaker events. I have been a member of the League of Women Voters. Helping my neighbors in times of a disaster is important to me. Through the Office of Emergency Services I was trained to be a PANDA and recently became a Block Preparedness Coordinator in Midtown. I appreciate what Palo Alto offers in the fine arts as a member of the Cantor Arts Museum and by taking painting classes at the Pacific Art League. I stay informed about our community's issues through the Midtown Residents Association and by attending or watching on cable TV City Council meetings. I enjoy learning at the Palo Alto Adult School, am a member of the Ross Road YMCA and shop and dine locally. I am proud to be a Palo Alto Resident and Homeowner for22 years and that my son is a Gunn High School graduate. My interest in serving as a member of the Human Relations Commission stems from my lifelong focus on social welfare, social interaction, and social justice, and a 40 year career as an educator. The culmination of my worklife was my final 18 years as the principal of Ardenwood School, avery large (840+ students) elementary school, in Fremont. I had the joyous opportunity to lead the school's integration of a character education program which over the 18 years transformed an ordinary school into an extraordinary one. Responsibility, caring, honesty, respect for others, citizenship, planning and decision making, problem solving, and integrity were our guiding values. These "8 Great Traits" were taught by teachers, modeled by adults, and committed to by all members of the school community (including parents). Gradually the campus became a safer, more tolerant, more welcoming environment. Not only did grades increase and student misconduct decrease, the positive school climate was palpable and lead to the school receiving a California Blue Ribbon Distinguished School Award. I have a deep desire to have my town be as good as it can be. I want to use my experience in building consensus with various constituents around values based decision making to develop Palo Alto to an even better place to call home. Paula Rugg 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU: LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Human Relations Commission The Safe Parking Pilot Program was brought to my attention a few months ago through my congregation's social action committee. Immediately I emailed my support of the Pilot Program to the City Council and soon watched the Members' discussion on TV. I walked around my neighborhood and visualized vehicles in the large most of the time empty parking lots of 4 churches within a five minute stroll of my home. I imagined how neighbors might respond; the good, the bad, and the ugly. Economic disparity resulting in homelessness and people sleeping in their vehicles is growing in our community and throughout the Bay Area. Wishing it away or ignoring it, is not a solution. It is not an easily addressed issue by a single social service agency or by a local government. It is a problem that takes a multigroup coodinated effort with advanced community awareness and engagement to even try to make an impact. I am pleased the City of Palo Alto has developed the Safe Parking Pilot Program and would diligently work on helping it succeed. The success of the program requires a tolerant citizenship willing to work and live respectfully with others. I would like to see the Human Relations Commission take a role in the Safe Parking Pilot Program. Working with City Staff, program providers, congregations, and Palo Alto residents around this issue is a concrete way to bring the words of the HRC mission statement "a community where civility, respect and responsible action are the norm" in to motion. The HRC can work with the stakeholders to promote awareness of the Program; host forums, knock on doors, meet with Residents Associations and congregation members, facilitate press announcements, post on Social Media, etc. The communication must reach as many residents as possible to avoid those who come to the table late and slow the process down to a halt. The communication must actively address concerns and fears and lead to workable solutions. This means premeetings with facilitators and presenters about respectful listening and use of procedures for effect civil discourse around sensitive issues. The process and successful implementation of the Safe Parking Pilot Program can then be used to establish dialogues and protocols which will benefit implementation of future HRC goals. Paula Rugg 4. Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. FKDUDFWHUV Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ ____________________________________ Date: _____________ Page 4 Human Relations Commission May 8, 2020 I do not have experience with these documents. Midtown Resident Bonnie94306@yahoo.com Paula Rugg Human Relations Commission Personal Information – Note: The HRC regularly meets the second Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Human Relations Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 characters) Page 1 Human Relations Commission Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk's Office: 650-329-2571 Lestina Trainor 32 Roosevelt Circle 203 482 2262 203 482 2262 lestina.trainor1@gmail.com 4 Boston College, BA Fordham University School of Law, JD Member of the Bar: New York, Connecticut Attorney 1998 - 2016 Lestina Trainor Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: (1242 characters) 1. What is it about the Human Relations Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) Page 2 Human Relations Commission Self Attorney Board of Directors, Family & Childrens Aid 2005 - present Guided executive team through tremendous growth and expansion over 15 years. Active in developing board governance, overseeing agency programs, acquisition of real estate and most recently, creating a task force to evaluate and implement changes to address systemic racism and inequity agency-wide, including on the Board of Directors. Board of Directors, League of Women Voters, Redding CT 2013 - 2019 In the wake of the Newtown Elementary school shooting, collected state-wide gun violence data and prepared a comprehensive study. Regular speaker at luncheons & panel discussions. Board of Directors, Connecticut Against Gun Violence 2013 - 2017 Founding member of March for Change, a grassroots movement demanding sensible gun legislation. Organized Valentines Day 2013 protest at the the state capitol building in Hartford attended by approximately 10k. Testified before state congress on multiple occasions. Board of Directors, Ridgefield Academy 2006 - 2008 Drafted school mission statement for Diversity & Inclusion. Organized/hosted fundraisers. Chairperson, The Fresh Air Fund 2009 - 2016 Recruited and vetted families in Connecticut to be summertime hosts to chil I recently moved to Palo Alto from the east coast. However, Ive spent a lifetime visiting Palo Alto to see my grandparents and other relatives. So in some respects, moving here feels a bit like coming home. I have always been an active participant in my community. I inherited this trait from both of my parents. Mom still tutors a linty of ESL students at the Mitchell Park and Rinconada librariesthough shes well past retirement age; and dad too, was an active volunteer teaching music in east bay schools until he passed away in 2009. I am eager to find my own volunteer opportunities in town. Not only do I love lending my talents to help make my community a better place, but I love meeting other people who share the same interest. Specifically, the HRC appeals to me because I have always been interested in advocating for vulnerable populations. My parents adopted a 3 year old boy when I was six. From that day on, I got an up close view of the many social/societal problems that surrounded the circumstances of his adoption: why he was up for adoption in the first place; the effects of foster care and multiple placements, the resulting setbacks in education and socialization that my brother faced. It really shaped our entire childhood. It also sparked my desire to study law with the intent of practicing child advocacy. Although my first job offer led my law practice in a different direction, I have continuously satisfied my need to serve and advocate for children through my volunteer work. Lestina Trainor 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1449 characters) 3. If appointed, what specific goals would you like to see the Human Relations Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Page 3 Human Relations Commission I just recently became aware of the HRC last week when I watched a Zoom Virtual Town Hall presented by Embarcadero Media entitled Race, Policing and the Color of Justice, sponsored by Palo Alto Online. I believe Police Chief Bob Jonsen mentioned the HRC in connection with his anticipating input from the Commission. I was so impressed by the discussion and panelists that I immediately set out Googling each of the speakers and researching ways that I could possibly could get involved with the conversation. The next day I happened upon a You-Tube Q & A with Reverend Kaloma Smith, Chief Jonsen and City Manager Ed Shikada. I was further intrigued, inspired and energized by the panelists intelligence, optimism and willingness to engage on the tough subjects of systematic racism and policing. In my volunteer work I have chaired several Diversity & Inclusion Committees, drafted mission statements and policies pertaining to equity, and evaluated institutions for implicit bias, etc etc. Law school only deepened my understanding of issues surround racial justice, constitutional law, and the criminal justice system. With a father who hailed from Birmingham, Alabama and who had been a student activist and personal associate of Martin Luther King, Jr. I have been studying this topic for as long as I can remember. I believe my voice would add great value to the HRC on this topic and beyond. I would love to see the Human Relations Committee come up with a list of recommendations to be adopted by PAPD that effect significant and meaningful change. The goal: to have a reimagined system of policing in Palo Alto where (ultimately) all residents feel safe and protected by PAPD. In just in the short time that I have been a resident, I have been made aware of several police incidents that definitely warrant further unpacking. I have also been told about, and read several accounts by, residents who defiantly have a deep (and warranted) distrust of the police. I feel strongly that now is the time to make significant changes to benefit the community as a whole. I loved the enthusiastic general consensus of Chiefs Jonsen, East PA Chief Pardini and former East PA Chief Ron Davis, on the Embarcadero Media Virtual Town Hall, that NOW is a unique opportunity to enact swift, meaningful and impactful change. I believe this can be accomplished by gathering as much anecdotal evidence as we can. Looking for patterns; looking at existing policies and procedures and evaluating if they are being followed or not. Then exploring how some existing procedures may be problematic because they have a disparate impact on Black people and POC. I understand that PAPD is already quite close to meeting 8 Cant Wait standard. Good, but I think we can go beyond that baseline. Id also love to explore what changes could possibly be achieved by challenging police union policies & state laws that sometimes diminish the authority of local police chiefs. Lestina Trainor 4.Human Relations Commission Members work with the documents listed below. If you have experience with any of these documents, please describe that experience. Experience with these documents is not required for selection. (690 characters) Human Services Needs Assessment LINK Muni Code 9.72 – Mandatory Response Program LINK Community Services Element of the Comprehensive Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: (Please type or sign)____________________________________ Date: _____________ Page 4 Human Relations Commission July 6, 2020 I have not worked with the specific documents attached. However in my capacity as an attorney I am accustomed to working with whatever document comes across my desk. I very much enjoy the process of digesting new information and interpreting/analyzing same. Lestina Trainor Public Art Commission Application 1 of 5 Personal Information Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Ph ____ Home / ____ Office Phone: E-mail: Are you a Palo Alto Resident? ____ Yes ____ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? ____ Yes ____ No Are you available and committed to complete the term applied for? ____ Yes ____ No California state law and the Ci require appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1)engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? ____ Yes ____ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? ___ Yes ___ No How did you learn about this vacancy? ____ Community Group ____ Email from City Clerk ____ Palo Alto Weekly ____ Daily Post ____City Website ____ Flyer Other: List relevant education, training, experience, certificates of training, licenses, or professional registration: 'IVXMJMGEXMSRSJ1YWMG:MHIS'IVXMJMGEXMSRSJ%VXW'YVEXMSR&EGLIPSV MR.SYVREPMWQ'SQQYRMGEXMSRERH4YFPMG6IPEXMSRW (NMFVMP(VEQI 7SYXL7]GEQSVI%ZIRYI dramedjibril@gmail.com Public Art Commission Application 2 of 5 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? ,EZIFIIRMR%VXWSZIVXLER]IEVW*VSQWXVIIXEVXTLSXSKVETL] JMPQERHTIVJSVQERGI 3VKERM^MRKGYVEXMRKGVIEXMRKI\GLERKMRKEVIWSQITSMRXWXLEXPMROQI [MXL4YFPMG%VX'SQQMWWMSR 1]GSQTEXMFMPMX][MXLXLMWTSWXMWXLEX-LEZIFIIRHSMRKKVEJJMXM WMRGI]IEVWSPHXLIRW[MXGLMRXSTLSXSKVETL]MREWE TVSJIWWMSREPFIIRHSGYQIRXMRKXLIKVEJJMXMWGIRIMR(EOEVWMRGI *VSQXLSWIHSGYQIRXEXMSR-QEHIETVSNIGXGEPPIH1]'SPSVJYP'MX]XLEX [IRXXS+IVQER]7IRIKEPERH-ZSV]'SEWX %JXIVGYVEXMRKEPSXSJI\LMFMXMSRWPEWX]IEV-LEZIHIGMHIHXSJSPPS[ E[SVOWLSTMRXS%VXW'YVEXMSRSVKERM^IHF]-RHITIRHIRX'YVEXSVW -RXIVREXMSREPMR(EOEV%QSRKXLIXIEGLIVW[ILEH7MQSR2NEQMEGXYEP GYVEXSVJSVXLI&MIRREPISJ(EOEV*VEROPMR7MVQERWSJXLI1MEQM4IVI^ 1YWIYQ -HSFIPMIZIXLEXQ]I\TIVMIRGI[MPPLIPTQIXSJMX 1MRMWXV]SJ0SGEP+SZIVRERGIMR7IRIKEP %WWMWXERXMR'SQQYRMGEXMSR &EGOLSQIMR7IRIKEP-LEZIFIIRMRZSPZIMRXSGSQQYRMX]SVKERM^EXMSRW ZSPYRXIIVMRKMRHMJJIVIRXRSRTVSJMXPMOI7IRIGS[MGLMWERSRTVSJMX JMKLXMRKEKEMRWXTSPPYXMSR -RWXIEHSJXLEX-LEZIFIIREPIEHIVMR(EOEV'VIEXMZI7GIRILIPTMRK HMJJIVIRXTIIVWXSWIXYTI\LMFMXMSRWGSRXEGXMRKTVIWWGYVEXMRK Public Art Commission Application 3 of 5 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? 3RISJXLIMWWYIXLEXGEQIFIJSVIXLIGSQQMWWMSRMWXLIHMZIVWMX]SJ XLI[SVOWERHXLIWYFNIGXW-[SYPHPSZIXSXEPOEFSYXQSVIXLI EGGITXERGISJKE]GSQQYRMX]ERHLS[XSLIPTXLI[SVPHXSI\GLERKIERH PMZIXSKIXLIV -[SYPHPSZIXSWIIQSVIHMZIVWMX]0SZIEGGITXERGIPMFIVX]TIEGI NS] 1]KSEPWEVIXSFVMRKEGGITXERGIERHVIWTIGXXLVSYKLEVXW%RH-HS FIPMIZIXLEXXLISRP]TPEXJSVQXLEXGERLIPTQIXSEGLMIZIMXMW4EPS %PXS4YFPMG%VX'SQQMWWMSR Public Art Commission Application 4 of 5 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Municipal Arts Plan -RIZIVJEGIHXS[SVO[MXLXLMWHSGYQIRX8LMWMWXLIJSVXWXMQIXLEX- LEZIFIIRWIIMRKXLMW-[SYPHPSZIXSKIXXSORS[EFSYXXLIHSGYQIRX F]KIXXMRKMRXSXLI'SQQMWWMSR Public Art Commission Application 5 of 5 Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, This consent form will not be redacted and will be attached The full code can be read here: Read the code, and check only ONE option below: _ Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: ____ Home / ____ Office Phone: ___________________________________________________ Email: ____________________________________________ The phone number / address can be nonpublic and different than the address collected on page one. (Optional) Additional Attachment(s) If you would like to submit a resume, work sample, etc. along with your Application, HVEQIHNMFVMP$KQEMPGSQ 7SYXL7]GEQSVI%ZIRYI 3XEOLF$UW&RPPLVVLRQ Personal Information ±1RWH 7KH3$&UHJXODUO\PHHWVWKHWKLUG7KXUVGD\RIWKHPRQWKDW SP Name: Address: Cell Phone: __Home / __Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for?__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you RU\RXUVSRXVHhave an investment in, or do you RU\RXUVSRXVHserve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you RU\RXUVSRXVHown real property in Palo Alto?__ Yes __ No How did you Oearn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience,certificates of training, licenses, or professional registration: FKDUDWHUV Page 1 Public Art Commission 1MFBTFFNBJMBMMDPNQMFUFEBQQMJDBUJPOTUP+FTTJDB#SFUUMF!$JUZPG1BMP"MUPPSHPS$JUZ$MFSL!$JUZPG1BMP"MUPPSH $JUZ$MFSLhT0GGJDF Marilyn Gottlieb-Roberts 763 East Charleston Road (seasonal) 305-323-9242 m427@bellsouth.net ✔ ✔ My active career in the arts includes exhibits in the United States and in Spain, Nigeria, England and Austria. 1980-2006 I was tenured Professor of studio art and art history at Miami Dade College,Miami FL;I taught a Master Class as a 1994 Visiting Artist at Harvard University. MFA in Painting and Drawing from the University of Miami in 1977. Published work includes an invited essay in the proceedings of a conference at the Museum of Science and Natural History published 2015 by the Astronomical Society of the Pacific. I was a Teaching/Research Fulbright Scholar to the University of Jos in Nigeria, 2000-2002. Marilyn Gottlieb-Roberts Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: FKDUDFWHUV 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? FKDUDFWHUV Page 2 Public Art Commission Miami Dade College(Ret.) Active professional artist 2006-2011 Executive Board, Interdisciplinary Sound Arts Workshop (iSAW), South Florida Composer’s Alliance. 2006 Co-Producer,"Kwagh-hir",video documentary filmed in Nigeria.Director, Charles Recher. 2006 Academic Reviewer,"Janson’s History of Art, Western Tradition, 7th Edition" (Pearson/Prentice Hall) 2004-2005 Invitee, National Science Foundation Math/Art Workshop; U Indiana & Franklin & Marshall College. 2002 Editorial review,"Story" by Harold Scheub,"Africa Today", Indiana University Press. 2002 Referee, "African Studies Review", the African Studies Association Journal. 1998 “Fulani Astral Traditions and the Epic of Gilgamesh; A Comparative Study”, Sub-Saharan Literature panel, African Studies Association Annual Meeting, Chicago IL. 1998 Site Ethnographer,"Internationalizing New Work in the Performing Arts",Ford Foundation, New England Foundation for the Arts. 1995 Illustrations for"Deftere Ledde E Pudi"[Atlas of Fulani Traditional Botany], Fary Silaat Ka, ARED Press, Dakar, Senegal. 1983-1986 Founding Director, Miami Waves Film & Performance Festival, Miami FL Over time I’ve served on many cultural panels,including those managed by the Dade County Cultural Affairs Council, the State of Florida Division of Cultural Affairs, and National Foundation for Advancement in the Arts. I am an experienced artist, arts educator and cultural activist with a record of service in a variety of community settings. Even though I am new to Palo Alto, I have noticed that the Public Art Commission has promoted art as an enriching source of community pride and enchantment, which is what inspired me to submit this application. Here are two concrete examples that are compatible with my experience and whose challenge interests me: Assuming interest from within Palo Alto's artistic community, I'd like to develop workshops in the history,theory and practice of the public art idiom. I'd like to support creation of an artwork intended to encourage awareness of the relation between the Palo Alto landscape and the overhead skyscape. For example, a large scale "treasure hunt" model of our solar system with durably cast scale models of the sun and planets. An artist might envision the commission as flat images in sidewalks or on the sides of buildings, or as durably cast objects (for example, a pumpkin for sun, lemon for Saturn, etc.) mounted atop pedestals set in to-scale distances apart. Marilyn Gottlieb-Roberts 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archiveGYLGHRIURPWKH0LGSHQ0HGLD&HQWHU:LINK FKDUDFWHUV 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? FKDUDFWHUV Page 3 Public Art Commission I was working on an installation in a building that overlooked the NYC Federal Courthouse where Richard Serra's "Tilted Arc" had just been installed; quite a few of the judges and lawyers who labored there were all hair-on-fire over it. I thought Serra had an interesting point to make--both for the piece itself and for the rumpus he fully intended to raise. The resulting controversy was healthy--both for the questions it addressed to those laboring in the halls of justice, and for publicizing the essential difference between "plop art" and site-integrated art. The furor created, on the other hand, by the "Digital DNA" sculpture Adriana Varella and Nilton Maltz installed in Lytton Plaza, while possibly ennobled by references to the "Tilted Arc" controversy, was fundamentally different. Personally, I liked the piece and its regional evocations, and I really liked it that the community was hotly engaged pro and con in this eggsistential controversy-- besides, how often does an art work get a crusading editor to do its PR for it. However, because I assume Ms. Varella was aware her work would likely be exposed to wear, I felt the real issue was the choice of materials and finish; which left the Commission with the difficult but necessary work of deaccession. I'd love to see the Commission keep on doing what it's been doing, and I'd love to be able to contribute to the effort. Marilyn Gottlieb-Roberts 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. FKDUDFWHUV 3XEOLF$UW0DVWHU3ODQ LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __Home / __Office Phone: E-mail: Signature: 3OHDVHW\SHRUVLJQ _______________________________________________ Date: _____________ Page 4 Public Art Commission 2020 May 4Marilyn Gottlieb-Roberts Page 1 Public Art Commission Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Radina J. Philyaw Address: 2125Park Blvd Cell Phone: (650)799-3109 _#_ Home / __ Office Phone: (650)322-1052 E-mail: radinaphilyaw@yahoo.com Are you a Palo Alto Resident? _x_ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes _x_ No Are you available and committed to complete the term applied for? x__ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes x__ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __x No How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: I met someone from the art commission at the BLM mural painting._____________________________________________________________________________ _ List relevant education, training, experience, certificates of training, licenses, or professional registration: Employment Present or Last Employer: City of Menlo Park (belle Have CDC ) Occupation: Teacher Describe your involvement in community activities, volunteer and civic organizations I actually don’t have any prior involvement. I was touched as well as proud to have this mural in my city. I want to become more involved in helping Palo alto display beautiful works of art. Page 2 Public Art Commission What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? I don’t have experience besides considering myself an artist. I do love art and like I stated earlier, I want to be more involved with my community. 1. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK. The BLM mural was/is such a wonderful experience for me. I went downtown the day the mural was being painted. It was so amazing to see so many different artist out there, creating such beauty for our city. To be honest, I was a little sad that I wasn’t a part of it. That day I introduced myself to almost all of the artist as well as members of the public that were out there, enjoying the experience as much as I was. I met someone that is a part of the art commission. We spoke for a little bit while being surrounded by such a great thing that was taking place. After speaking with the art commission member, I realized that that this would be something I would love to be a part of. 2. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? I would like to see more murals going up in different areas in Palo alto. I would explore the city in efforts to determine which places to choose. I would work with the team to see who would be the best person/artist to do the job. Page 3 Public Art Commission 3. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” The full code is attached. This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: x I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E- mail: Page 4 Public Art Commission Signature: ______Radina J Philyaw__________________________________________________ Date: __7/19/2020___________ Page 1 Public Art Commission Hsinya Shen __ __ __ __ __ __ Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk’s Office: 650-329-2571 Public Art Commission Personal Information - Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Hsinya Shen Address: Cell Phone: Home / 650-888-7052 Office Phone: E-mail: Hsinyashen@yahoo.com Are you a Palo Alto Resident? __ Yes No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? Yes No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Yes No Excluding your principal residence, do you or your spouse own real property in Palo Alto? Yes No How did you learn about the vacancy on the Public Art Commission? Community Group Email from City Clerk Palo Alto Weekly Daily Post City Website Flyer Other: I currently serve on the Public Art Commission. List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 charaters) I have served on the Palo Alto Public Art Commission for the last 3 years and would love the opportunity to continue to contribute based on all I have learned in the last 3 years. Outside of the PAC, I am a life long student and appreciator of the arts. I studied Art History at Wellesley College. I have spent significant time renovating properties and landscape and community building within Palo Alto. I have a demonstrated interest in community betterment and improvement through the arts. Page 2 Public Art Commission Hsinya Shen Employment Present or Last Employer: Akamai Technologies, Inc. Occupation: Attorney Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) I have served on the Palo Alto Public Art Commission for the last 3 years and would love the opportunity to continue to contribute based on all I have learned in the last 3 years. Outside of PAC, having served on the board of a community bank for nearly a decade, I have supported community reinvestment and outreach programs. Also, leveraging my legal background, I have provided community pro bono legal support, including citizenship drive. 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) I believe art can cultivate the human spirit, enhance communication, and promote relationships and community building. While Palo Alto is a suburban city in size and location, it has an international draw and reach. Daily, Palo Alto also draws talents from neighboring towns and brings together a wonderfully diverse population, many of whom welcome the opportunity to get to know the city and connect with the community. As a Palo Alto resident, I have often enjoyed artistic contributions from individual families and businesses. Supplementing these efforts, I believe the Public Art Commission, by investing in different areas of Palo Alto with diverse public art projects, can create spaces and foster opportunities for people to meet, connect, participate, and enrich our community. Page 3 Public Art Commission Hsinya Shen 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1518 characters) One particularly impressionable project for me was by a developer on University Avenue. This developer insisted on spending its 1% public art commitment onsite and ended up proposing a public art sculpture in a dangerous and invisible location, both endangering pedestrians and detracting from the beauty of the building. It is always the individual developer’s choice whether to contribute their 1% public art commitment to the in-lieu pool. If we can show how successful public art projects funded by in-lieu fund improve the city overall, we can hopefully inspire future developers to fulfill their public art commitment with a contribution to the in-lieu fund when their onsite options are limited. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) As a member of the Public Arts Commission, I would like to continue to support projects like California Ave. Master Plan and policies related to important issues like deaccession that will allow us to update public art projects in Palo Alto systematically. Palo Alto is a diverse city by population. Palo Alto Public Art projects reflect its population's diverse prospective, and it would be important to continue to ensure diversity in our public artworks. 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. (759 characters) Public Art Master Plan LINK I have a great appreciation for the Public Art Master Plan. It helps Palo Alto public art team to support an incredibly rich portfolio of short, medium, and long term projects all over Palo Alto. Adhering to the missions and visions outlined in this plan will help the public art team continue to deliver exciting public arts to the city. Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: C/O City of Palo Alto Cell Phone: Home / 650-888-7052 Office Phone: E-mail: Hsinyashen@yahoo.com Signature: (Please type or sign) Hsinya Shen Date: 4/20/20 Page 4 Public Art Commission Public Art Commission Personal Information – Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: __ Home / __ Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes __ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? __ Yes __ No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? __ Yes __ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? __ Yes __ No How did you learn about the vacancy on the Public Art Commission? __ Community Group __ Email from City Clerk __ Palo Alto Weekly __ Daily Post __ City Website __ Flyer Other: ______________________________________________________________________________ List relevant education, training, experience, certificates of training, licenses, or professional registration: Page 1 Public Art Commission Harriet Stern 1675 Middlefield Road, Palo Alto 408-893-5199 jacobeatrice@gmail.com X X X X X X BA, Art History, Kenyon College, Gambier, Ohio MA Studies, Modern Art History ,Theory and Criticism, School of the Art Institute of Chicago Diploma, Interior Architecture, Inchbald School of Design, London Internships: Hirshhorn Museum and Sculpture Garden, Washington D.C.; Peggy Guggenheim Collection, Venice, IT Chicago Park District, Archives Department; Art Institute of Chicago, Department of 20th Century Art Teaching Assistant, School of the Art Institute of Chicago Assistant Director, White Pine Gallery, Chicago Corporate Art Consultant, Merrill Chase Galleries, Chicago and Corporate Artworks, Schaumberg, IL Curator, IBEW Local 1245, Vacaville, CA Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? Page 2 Public Art Commission My last full-time employer was Corporate Artworks now located in Arlington Heights, IL. There I served as an Art Consultant. Since living in Palo Alto I have free-lanced as a curator for the IBEW Local 1245 in Vacaville. In my community I have taken a number of classes at Pacific Art League, Mid-Peninsula Media Center, The Art Center. I attend lectures and music at Stanford, visit arts programming often at all sorts of venues from open studios to the Anderson Collection and everything in between. We attend lots of community and regional theater. I have kids in PAUSD since 2018. I try to stay active and up to date with local and school affairs. For example I have been one of those people writing letters about the airplane noise! Palo Alto Weekly subscriber! My volunteering has been around school for the most part. I try to do one long-term commitment a year coupled with as many one-off assignments possible. To give an example, these are my recent longer term volunteer commitments: Odyssey of the Mind Coach, Elementary Division, The Harbour School, Hong Kong, World Championship Qualifiers, 2017 All Students Matter, Ravenswood School District, Weekly Literacy Volunteer, 2018/19 Palo Alto High School, Weekly Career Counselling Center Volunteer, 2019/2020 A first time visitor comes to Palo Alto City Hall and sees our new Black Lives Matter mural and engages with Cache Me If You Can. They keep walking and see many examples of art around our city. With these public art works Palo Alto signals that creativity and expression are celebrated here. These art works project our community’s values and vision. The Public Art Commission serves a critical role in the direction of this vision—aesthetic and cultural. My specific interest in serving on The Commission is to maintain the public’s trust and the responsible management of our community’s collections, future acquisitions and programming pursuant to our vision. It is my opinion that art should be integral to our city. Palo Alto should support our local artists. We should engage partners to build support for public art and I would like to help create awareness about the program and the collection with community outreach. My experience as a Corporate Art Consultant would serve me well as a Commissioner as I often commissioned artists to create site specific work. I have worked in both commercial and not-for-profit art environments. 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? Page 3 Public Art Commission The Commission has addressed some interesting subjects recently that will be ongoing. One which particularly resonates is that of cultural and racial equality in the field of public art. The BLM mural project was immediate and inclusive, relevant and responsive. How about reaching across the 101 and working with our brothers and sisters in EPA to create something together? Expanding the reach and flexibility of public art interests me. One issue I thought would come up was censoring Cece Carpio’s image of Assata Shakur but was happy to learn there were only letters in support of keeping the mural as it stands. Another issue that interested me was City Council’s recommendation to reduce the Public Art Commission from 7 to 5 Commissioners. What is the net gain in that and is it just a recruitment issue? I would think that the PAC works best with seven diverse points of view to put forth recommendations to City Council, especially as we seek cultural and racial equality in Palo Alto’s future public art goals. Isn’t the river mightier with many tributaries than fewer? As for the BLM mural, which is a huge success and a source of civic pride, it literally would have been difficult to achieve with fewer physical bodies on the Commission. All the Commissioners worked overtime to make that happen seemingly overnight-- quite a remarkable effort at anytime but doubly so given our very unusual world in 2020. World standards of public art and place-making are changing by the minute as we become more culturally and racially aware. It is quite interesting that two years ago our own community renamed two middle schools because some inquisitive students discovered that they are named after some old racists and whose ideologies were incompatible with our current civic vision. This year third-rate Jim Crow-era monuments are being toppled from their plinths and the Washington Redskins are finally being renamed—(when did Stanford drop the name Indians?). The Public Art Commission must always be sensitive that the permanent public art Palo Alto creates today will be judged well in 100 years time. In the same breath, as a student of art history, I revere monuments left by less than perfect societies of the past. How can we not be touched by the magic of Venice or magnificence of Michelangelo’s Pieta or Sistine Chapel? Those sublime Vermeers and the riches of the Rijks Museum, all funded less than ethically if we consider them through or 21st C. lens. These are the challenges those who leave lasting marks, no matter the sector, must consider. It is an exciting time to be in engaged in public art, to change-up the dialogue, to re-direct the discourse. How the world communicates has changed so much since Palo Alto’s Public Art Program was established; it has changed so much in the past six months! Weddings, Baptisms, Funerals by Zoom? For me, the future of public art in Palo Alto reaches a wider community. It speaks to more people— engages across classes, races, ages and genders. Maybe that is through social media and Submittable. Permanent installations need to reflect diversity. Perhaps that means physically going into places we didn’t go before and creating flash events and ride-alongs. Maybe it is making more temporary, ephemeral art that reacts to current events and that taps into the pulse of the moment. No doubt the future of public art is more racially and culturally equitable in acquisitions and programming. The recent BLM mural is a great example of a new wave of public art in PA—responsive, nimble, loads of submissions, exciting and creating lots of interest and civic pride. (This is a great way to increase recruiting for the Public Art Commission as well). I would also like to see Palo Alto teaming with neighboring communities to create art and build friendship and trust. 4.Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan LINK Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” The full code is attached. This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: __ Home / __ Office Phone: E-mail: Signature: ________________________________________________________ Date: _____________ Page 4 Public Art Commission 07/21/20 X Yes, I am familiar with the Master Plan. I attended a focus group with the authors and have read the final document. I know that we are about halfway through the ten year plan. The Master Plan has effectively established a professional approach to our Public Art Program and its administration. The goals and timeline are very clearly stated. The Cubberley Artist Studios are included in the Master Plan as a point of discussion. It is my very strong opinion that if Cubberley is used for something else in the future, Palo Alto should maintain subsidised artist studios somewhere within our city limits. Artists enhance diversity of our community. They can't afford to be here without our support. Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 1 of 5 Personal Information Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Address: Cell Phone: ____ Home / ____ Office Phone: E-mail: Are you a Palo Alto Resident? ____ Yes ____ No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? ____ Yes ____ No Are you available and committed to complete the term applied for? ____ Yes ____ No California state law and the Ci require appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? ____ Yes ____ No Excluding your principal residence, do you or your spouse own real property in Palo Alto? ___ Yes ___ No How did you learn about this vacancy? ____ Community Group ____ Email from City Clerk ____ Palo Alto Weekly ____ Daily Post ____City Website ____ Flyer Other: List relevant education, training, experience, certificates of training, licenses, or professional registration: DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B 'LIGOIHXLI[IFWMXISJXLI4%%VXW'SQQMWWMSR OEXMIEXEPFSX$LSXQEMPGSQ /EXLIVMRI8EPFSX 0SRKXMQI7XERJSVHVIWMHIRXEGXMZIQIQFIVSJXLI7XERJSVHERH4% GSQQYRMXMIW-EP[E]WRSXMGIXLIEVXMRXLIGSQQYRMX]ERHXLMROEFSYX MX-LEZIFIIRXIEGLMRK/JSVXLIPEWX]IEVW QSWXP]WGMIRGI ERHEQEP[E]WHIPMKLXIH[LIR-JMRHQ]WIPJMRSRISJXLIEVX GPEWWVSSQW-[SYPHPSZIXSFVMRKEPMROFIX[IIR4EPS%PXS WWGLSSP EKITSTYPEXMSRERHEVXMWXWERH4EPS%PXS WZIV]TPIEWERXSYXHSSVERH TYFPMGWTEGIW8IEGLMRKGVIHIRXMEPWMR&MSPSK]4L]WMGWERH'LIQ .YRMTIVS7IVVE&PZH7XERJSVH Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 2 of 5 Employment Present or Last Employer: Occupation: Describe your involvement in community activities, volunteer and civic organizations: 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -EQGYVVIRXP]WMXXMRKMR1V*IVVIVE WEVXGPEWWEX4EPS%PXS,MKL 7GLSSP-EQWYVVSYRHIHF]]SYRKMRXIVIWXIHERHMRXIVIWXMRKEVXMWXW [LSEVIEPQSWXGSQTPIXIP]EFWSVFIHMRXLI[SVO-XMWMRWTMVMRKXLIMV [SVOMWVIEPP][SVXLPSSOMRKEX,EZMRKXEPOIHXSXLIQEFSYXXLI WXEXYWSJEVXMR4EPS%PXS-EQMRWTMVIHXSETTP]JSVXLI4EPS%PXS %VXW'SQQMWWMSR-LEZIEP[E]WFIIRMRWTMVIHF]XLIEVXTEXXIVRMRK ERHHIWMKRMRWGMIRGIQ]EVIESJXVEMRMRK3ZIV]IEVWSJRSXMGMRK XLIEVXERHHIWMKREVSYRHQIERHMRSXLIVTPEGIWMRXLI97ERH PSSOMRKJSVEVXMR4EPS%PXS-[SYPHIRNS]FIMRKQSVIMRZSPZIH-EQ XLSYKLXJYPVIEH]XSPMWXIRERHPIEVRHMWGYWWERHGSQTVSQMWI-PSZI EVX WEFMPMX]XSQEOITISTPIRSXMGIXLMROPEYKLJIIPERHFIGEPQ 4EPS%PXSLEWEKSSHGSQTVILIRWMZITPERJSVEVXMRTPEGI2S[MX W XMQIXSMQTPIQIRXERHQEOI4EPS%PXSETPEGIXLEX W[SVXLPSSOMRKEX JSVQSVIXLERMX WIRZMVSRQIRXEPEXXVMFYXIW4EPS%PXS[SYPHFIRIJMX JVSQQSVITYFPMGEVXERHGSYPHIEWMP]FIEREVXPIEHIVERH-[SYPH PSZIXSFVMRKQ]JIEVPIWWWX]PIERHWXVSRKEFMPMX]XSJSVKIGSRWIRWYW XSLIPTQEOIXLMWLETTIR ,EZMRKVEMWIHX[SGLMPHVIRVIWMHMRKMR7XERJSVHERHWGLSSPIHMR4EPS %PXS-TEVXMGMTEXIMRXLIWGLSSPWXLVSYKLWGMIRGIJEMVWWYFWXMXYXI XIEGLMRKERH'LSSWMRK7GLSSP2EQIW'SQQMXXII-TEVXMGMTEXIMR4EPS %PXS0MXXPI0IEKYI GSEGLMRK'LEPPIRKIV7TIGMEP2IIHW8IEQ ERH7TIGMEP 3P]QTMGW XVEGOGSEGL -TEVXMGMTEXIMRXLI0IEKYISJ;SQIR:SXIVW LSYWMRKERHXVERWTSVXEXMSRGSQQMXXIIVIKMWXIVMRKLMKLWGLSSPZSXIVW ERHGSQQYRMX]IHYGEXMSREFSYXFEPPSXMRMXMEXMZIW 3YVJEQMP]MRER EGXMZIYWIVSJ4EPS%PXS WTEVOW-EPWSFMOIEPPEVSYRH4EPS%PXSXS VIEGLQ]WYFWXMXYXIXIEGLMRKKMKWWS-JIIPZIV]GSRRIGXIHXSXLI TL]WMGEPIRZMVSRQIRXEW[IPPEWXSXLIWGLSSPEKIHTSTYPEXMSR 4EPS%PXS9RMJMIH7GLSSP(MWXVMGX XIEGLIV Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 3 of 5 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -JSPPS[IHXLIMWWYIWEVSYRHXLIVIHIWMKRSJ'EPMJSVRME%ZIRYIERHXLI EVXSR%PQEERHSR9RMZIVWMX]MRXLIRI[WTETIVWERHMRTIVWSR- HIJMRMXIP]LEZISTMRMSRWEVSYRHXLSWIMWWYIWTEVXMGYPEVP]EFSYXXLI GSWXWSYVGMRKTIVQERIRGIERHTPEGIQIRXSJEVX-EPWSXLMROEFSYX XLITSWWMFMPMXMIWJSV4EPS%PXSXSFIETPEGI[LIVI]SYRKTISTPIEVI MRWTMVIHERHF]XLIEVXEVSYRHXLIQPIEVRJVSQMXERHGSQIXSI\TIGX XLEXXLIMVPMJIWLSYPHFIWYVVSYRHIHF]ERHIRVMGLIHF]EVX-PSZIXLI IRZMVSRQIRXEPEVXXLEXXLIGSQQMWWMSRMWTYVWYMRKMRXLI&E]PERHW-X [SYPHRSXLEZISGGYVVIHXSQIXSZMI[XLEXEWEVX MXMWEZIV] WMKRMJMGERXTVSNIGX 8LMWUYIWXMSRMWSFWGYVIHERHEPP-GERWIIMX,S[[SYPH]SYWYKKIWX EGGSQTPMWLMRKXLMW# ,S[HS[IKIXSYVXEPIRXIH]SYRKWXIVWMRZSPZIHMRERHIRNS]MRKXLIEVX EVSYRHXLIQ#0SSOMRKEXI\EQTPIWSJTYFPMGEVXJVSQEVSYRHXLI97 XLIVI[IVIZIV]RMGII\EQTPIWSJQYVEPEVXERHGVSWW[EPOEVX[LMGL VIEPP]PMZIRYTGMX]WGETIW0IZIVEKMRKXLIXEPIRXMRSYXGSQQYRMX] GVSWW[EPOEVXXLEXMRGVIEWIWTYFPMGWEJIX]ERHKMZIWYWIVWEVIEPWIRWI SJTPEGIGERIEWMP]FITVSHYGIH7XVIIXEVXMREPPSJMXWJSVQW [SYPHQEOIWIGXMSRWSJ4EPS%PXSQSVIPMZIP])ZIRWSQISJ4EPS W FIEYXMJYPXVIIPMRIHWXVIIXW[SYPHLSWXGEVIJYPP]GLSWIREVXXLEXMW GSQQYRMX]NYVMIHERHVIJPIGXMZISJXLIIRZMVSRQIRX ,EZMRKEWTEGI[LIVIEVXMWHMWTPE]IHZIV]TYFPMGP]GSYPHWLS[GEWILMKL WGLSSPSV7XERJSVHEVXERHGSYPHXYVRSZIV[IIOP]SVQSRXLP]8S MRGVIEWII\TSWYVIXSEVXXLIWII\LMFMXWWLSYPHFITPEGIH[LIVIQSWX TISTPI[SYPHWIIXLIQEXQER] PSGEXMSRWEVSYRHXLIGMX]ERHMR XLIRIMKLFSVLSSHW;IEXLIVVIWMWXERXHMWTPE]GEWIW[MXLVSXEXMRKLMKL WGLSSPEVX[SYPHTVSZMHIVIWMHIRXW[MXLERIMKLFSVLSSHHIWXMREXMSRERH MRGVIEWIXLIEQSYRXSJJSSXXVEJJMGMRSYVRIMKLFSVLSSHW ,S[HS[IKIXEVXXLEXMRXIVEGXW[MXLSYVIRZMVSRQIRX#-PSZIHVIEHMRK EFSYXXLITVSNIGXXSMRGVIEWIFYVVS[MRKS[PRIWXMRKJSVEKMRKMRXLI FE]PERHW-[SYPHJSGYWSRTYFPMGM^MRKXLIWITVSNIGX Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 4 of 5 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. Public Art Master Plan DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B -NYWXVIEHEPQSWXEPPSJXLIHSGYQIRXERHJSYRHMXXSFIGSQTPIXIERH GSQTVILIRWMZI2MGINSFTVSHYGMRKXLMW[IPP[VMXXIRHSGYQIRX2S[MX MWXMQIXSMQTPIQIRXXLIWIVIGSQQIRHEXMSRWERH- HPSZIXSFIMRZSPZIH Not ready to submit 1. Click OTHER ACTIONS Your Application? 2. Click FINISH LATER Public Art Commission Application 5 of 5 Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, This consent form will not be redacted and will be attached The full code can be read here: Read the code, and check only ONE option below: _ I give permission for the City of Palo Alto Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: ____ Home / ____ Office Phone: ___________________________________________________ Email: ____________________________________________ The phone number / address can be nonpublic and different than the address collected on page one. (Optional) Additional Attachment(s) If you would like to submit a resume, work sample, etc. along with your DocuSign Envelope ID: C30CBA5E-7147-4FA8-9342-292C19C5B70B .YRMTIVS7IVVE&PZH7XERJSVH OEXMIEXEPFSX$LSXQEMPGSQ Page 1 Public Art Commission __ __ __ __ __ __ Please email all completed applications to Jessica.Brettle@CityofPaloAlto.org or City.Clerk@CityofPaloAlto.org City Clerk’s Office: 650-329-2571 Public Art Commission Personal Information - Note: The PAC regularly meets the third Thursday of the month at 7:00 p.m. Name: Nia Taylor Address: Cell Phone: Home / Office Phone: E-mail: Are you a Palo Alto Resident? __ Yes No Do you have any relatives or members of your household who are employed by the City of Palo Alto, who are currently serving on the City Council, or who are Commissioners or Board Members? Yes No Are you available and committed to complete the term applied for? __ Yes __ No California state law requires appointed board and commission members to file a detailed disclosure of their financial interests, Fair Political Practices Commission, Conflict of Interest, Form 700. Do you or your spouse have an investment in, or do you or your spouse serve as an officer or director of, a company doing business in Palo Alto which you believe is likely to; 1) engage in business with the City, 2) provide products or services for City projects, or 3) be affected by decisions of the board or commission you are applying for? Yes No Excluding your principal residence, do you or your spouse own real property in Palo Alto? Yes No How did you learn about the vacancy on the Public Art Commission? Community Group Email from City Clerk Palo Alto Weekly Daily Post City Website Flyer Other: current commissioner List relevant education, training, experience, certificates of training, licenses, or professional registration: (621 charaters) Current Public Art Commissioner (Since May 2014) Art Educator MA in Visual Arts Administration Minor in Art History Page 2 Public Art Commission Employment Present or Last Employer: Congregation Sherith Israel Occupation: Membership & Development Manager Describe your involvement in community activities, volunteer and civic organizations: (1311 characters) Commissioner, City of Palo Alto Public Art Commission, May 2014 - present Volunteer, Friends of Lafayette Park, 2014 - present. Once a month I clean and beautify Lafayette Park in San Francicso. The park is 3 blocks from my current place of employment. Volunteer, Jewish Family and Children’s Services, 2010 - present. I help the organization package and deliver food packages for homebound seniors during Jewish holidays. 1. What is it about the Public Art Commission that is compatible with your experience and of specific interest to you, and why? (1518 characters) With a background in visual arts administration, art education, and art history, I love creating, talking, and viewing art in all its forms. I am a firm believer that art, as much as possible, should free and accessible to all people, hence the reason I initially decided to apply for a position on the Public Art Commission. Since my tenure, I have thoroughly enjoyed working with my fellow commissioners, public art advisors, architects, and community members, to procure, and protect, public art that will beautify and enhance the City of Palo Alto. Page 3 Public Art Commission 2. Please describe an issue that recently came before the Commission that is of particular interest to you and describe why you are interested in it. If you have never been to a Commission meeting you can view an archived video from the Midpen Media Center: LINK (1518 characters) Although I enjoy all aspects of being on the Public Art Commission, I have become particulary interested in our Percent for Art in Private Development Program. I especially like that it encourages developers to a) support artists and the visual arts, and b) promote art as a cultutral resource for the community. Since joining the commission in 2014, we have supported a number of Percent for Art in Private Development projects, many of which are currently on public view. If given the opportunity to continue for another term, I hope that I will be able to inspire more private developers to seek and display public art that is thought provoking and positively invites public interaction. 3. If appointed, what specific goals would you like to see the Public Art Commission achieve, and why? How would you suggest accomplishing this? (1656 characters) Goal #1: Develop a marketing campaign (e.g. bus and newspaper ads, banners, poster, etc.) that would promote and enhance the visibility of our wonderful collection. Ways to meet goal: Contact local media outlets (Weekly, PA Daily Post, blogs) and ask if they would publicize some of the works in our collection and/or enable us to place a low-cost and/or free ad promoting the collection. Goal #2: Enhance California and University Avenue by adding art inside empty store fronts and/or art onto contrusction barriers. Ways to meet goal: Ask artists (local and non-local, professional and novice) to submit 2-D works of art which we could hang inside empty storefronts and/or onto construction barriers. (Fun fact: I had the pleasure of being on a panel to choose art for a contrustion barrier behind California Avenue. It was a huge success.) Page 4 Public Art Commission 4. Public Art Commission Members work with the document listed below. If you have experience with this document, please describe that experience. Experience with this document is not required for selection. (759 characters) Public Art Master Plan LINK I was on the commission when the Master Plan was being developed. I have also had the great pleasure of being on the commission to implement many of the suggested recommendations. I hope that I will have the opportunity to continue turning suggested recommendations into actions should I be chosen to complete another term on the PAC. Consent to Publish Personal Information on the City of Palo Alto Website California Government Code Section 6254.21 states, in part, “No state or local agency shall post the home address or telephone number of any elected or appointed official on the Internet without first obtaining the written permission of that individual.” This consent form will not be redacted and will be attached to the Application and posted to the City’s website. The full code can be read here: LINK Read the code, and check only ONE option below: I give permission for the City of Palo Alto to post to the City’s website the attached Board and Commission Application intact. I have read and understand my rights under Government Code Section 6254.21. I may revoke this permission at any time by providing written notice to the Palo Alto City Clerk. OR I request that the City of Palo Alto redact my home address, phone numbers, and email address from the attached Board and Commission Application prior to posting to the City’s website. I am providing the following alternate information and request that they use the following contact information instead. Address: Cell Phone: Home / E-mail: Office Phone: Signature: (Please type or sign) Date: 3.31.2020 City of Palo Alto (ID # 11490) City Council Staff Report Report Type: Action Items Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: Foothills Park Pilot Program Title: Discuss the Parks and Recreation Commission's Pilot Program to Increase Access to Foothills Park for Non-residents and Provide Direction to Staff (Continued From June 23, 2020) From: City Manager Lead Department: Community Services Recommendation Staff recommends that City Council discuss the Parks and Recreation Commission’s proposed pilot plan to increase access to Foothills Park for nonresidents and either: a. direct staff to return with an Ordinance to amend the Municipal Code to allow non-residents to access Foothills Park under a pilot plan and a Resolution to define the pilot plan itself, or b. provide feedback and direct staff to explore and evaluate alternative scenarios to open Foothills Park to non-residents. Background The land comprising Foothills Park was acquired by the City in a favorably priced acquisition from the Lee family in May 1959, on the condition that it be preserved as open space. Los Altos and Los Altos Hills were asked to contribute to the purchase but declined. Foothills Park was opened to the public on June 19, 1965. In 1969, the City added the residency requirement to the Palo Alto Municipal Code (PAMC § 22.04.150 (a)-(b).), which limited admission to the Park to Palo Alto residents and their accompanied guests. Over the years, there has been interest in opening Foothills Park to non-residents. In 1973, the City Council unanimously reaffirmed the residents-only policy, pointing out that the park’s acquisition was paid for out of the City's general fund, and no federal funds were used. The residency requirement was brought up again in 1991 and 2005, and both times Council voted to reaffirm the residency requirement. City of Palo Alto Page 2 In 2005, in exchange for $2 million in grant funding from California Coastal Conservancy and Santa Clara County to help purchase 13 acres of land adjacent to the Pearson Arastradero Preserve, City Council voted to allow non-residents to enter Foothills Park via the Bay to Ridge trail. Non-resident hikers may enter from the Pearson-Arastradero Preserve and from Los Trancos Open Space Preserve. At the most recent joint session with the City Council, members of the Parks and Recreation Commission (PRC) indicated their interest in developing options to revisit opening Foothills Park to non-residents. Discussion The PRC and its Foothills Park ad hoc committee have studied several options for providing non-residents with access to Foothills Park since 2018. The PRC discussed the Foothills Park Pilot Plan at their July, September, and November 2019 meetings. At the November 12, 2019 Commission meeting, the PRC voted 6-1 to recommend that City Council direct staff to implement the Foothills Park Pilot Program as set out in the Commission’s November 12, 2019 report (Attachment A). This item was tentatively scheduled for an April 2020 City Council meeting but was deferred due to the public health emergency and focus on community response to the pandemic. Timeline If City Council approves the PRC’s recommended pilot plan Municipal Code changes provided in Attachment A, staff would return to City Council in September 2020 with an Ordinance to amend the Municipal Code to authorize non-residents to access Foothills Park under a pilot program, and a Resolution with the specifics of the pilot program itself. If approved, staff would need to prepare for implementation and anticipates being able to begin the pilot in Fall of 2020. Resource Impact There is a risk that additional visitation may negatively impact Foothills Park’s natural resources and improvements. This risk is considered limited given past experience with visitation levels significantly higher than what is anticipated in connection with the pilot program. Additionally, the pilot program has been designed to allow staff to adjust the number of available passes to control visitation and avoid impacts to park resources. Details on historic visitation levels; existing regulations limiting daily visitation; and Staff’s plan to assess impacts to the Park’s ecology, infrastructure, and maintenance needs resulting from additional visitors are provided in Attachment A. Additional staff time will be required to implement the pilot program, which may result in reduced staff attention to other projects. Open Space staffing resources are further City of Palo Alto Page 3 strained by the freeze of the vacant Foothills Park Supervising Ranger position, which was frozen as part of the adopted FY 2021 Operating Budget. Staff will redirect existing resources as needed to implement the pilot program while still maintaining Open Space services. The PRC’s pilot program includes the option to assess fees for non-resident passes to enter the park. Stakeholder Engagement The PRC discussed the Foothills Park Pilot Program at the July, September, and November 2019 Parks and Recreation Commission meetings. A panel discussion on the various perspectives of opening Foothills Park to nonresidents is planned for the July 28, 2020 PRC meeting. A summary of panel discussion will be shared during the presentation on this topic at the August 3, 2020 Council meeting. Environmental Review The subject project has been assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the City’s environmental regulations. Specifically, the City, acting as the lead agency, finds this project exempt from CEQA in accordance with CEQA Guidelines Section 15301 (Existing Facilities). There are no physical improvements to Foothills Park proposed as part of this pilot program. This exemption applies to the pilot program only and any expansion of the program may require additional CEQA analysis. Attachments: • Attachment A - PRC Foothills Pilot Project Memo 1 To: City Council From: Parks & Recreation Commission Re: Report and Recommendation for Foothills Park Access Pilot Program Overview The Parks & Recreation Commission (“PRC”) and its Foothills Park ad hoc committee (the “Committee”) have studied options for providing non-residents with access to Foothills Park (the “Park”) for over a year, with public PRC meetings on the topic in July, September and November 2019. The PRC and the community recognize that Foothills Park is a special place and the pilot program outlined herein utilizes robust visitation information to ensure that the Park retains its special character. At the same time, the PRC recognizes that current policy requires staff to turn away several thousand would-be visitors each year—approximately 60 people per week—and that there are means available to responsibly share the park with those visitors. Key parameters of the pilot program proposal: •One-year pilot program to test the concepts of providing (1) a limited and adjustable number of Park passes for non-residents, and (2) broader availability for student fieldtrips. •Non-resident passes would be available on the City’s new online reservation portal. Thissystem will allow us to gather information about those seeking to visit the Park. •Staff will use robust historic visitation data to adjust the number of non-resident passes available per day, with a maximum cap of 50 passes for any given day. •City will encourage and formalize a school field trip program and reservation process, whichis not presently anticipated by the Municipal Code for nonresident students. •$6 fee for non-resident passes will allow the City to recover a portion of the expensesassociated with the existing cost of staffing the entry gate. •Continue to prioritize resident access—no changes to current access policy for residents. •At conclusion of pilot, staff and PRC would review Park visitation and impact data, and recommend how to move forward, including potentially reverting back to the current policy,making the pilot program permanent, or making other revisions. The PRC has considered numerous alternatives (discussed below) and recommends this pilot program because it ensures close control of total visitation to the Park and allows the option to assess fees for non-resident passes to recover at least some of the significant personnel costs related to staffing the entry gate. Background The approximately 1,400-acre parcel comprising Foothills Park was acquired by the City in a favorably-priced acquisition from the Lee family in the late 1950s. The Park opened to Palo Alto residents in the 1965-66 fiscal year. Visitation when the Park opened was significantly higher than it has been in the past 30 years (peaking at approximately 372,000 visitors for two consecutive years Attachment A 2 in the early 1970s).1 In the past 17 years, visitation has been steady at approximately 152,000 persons visiting each year. One recent exception was 2011-2012 when the Park saw 202,000 visitors. Based on staff observation, the Park was a bit busier in 2011-2012, but that number of visitors did not negatively impact the Park’s resources and infrastructure. Enacted in 1969, the Municipal Code makes it a misdemeanor for any non-resident to enter the Park unless they are a guest of a City resident or employee, or are traversing the Bay-to- Foothills Trail on foot. (PAMC § 22.04.150 (a)-(b).) In addition to the residency restriction, the Municipal Code imposes a cap of 1,000 persons in the Park at any time. (P.A.M.C. § 22.04.150.) This limit has not been approached except in the case of a special event many years ago. During most weekends and holidays, the single point of entry on Page Mill Road is staffed regularly and persons not able to demonstrate Palo Alto residency are turned away from the Park. The exception is that during winter weekends and holidays, when staff is constrained and park visitation rates are lower, entry gate enforcement of the residency requirement is less frequent. In the last five years, approximately 2,800 non-residents have been turned away on weekends each year, which is an increase from the last decade. For the most recent year with complete data, more than 3,700 persons were turned away at the gate. Enforcement of the residents-only restriction requires that the Page Mill gate be staffed, with associated costs estimated by staff to be approximately $89,000 per year. As written, the Municipal Code provides no discretion for the City Manager or staff to allow unaccompanied non-residents, including school or volunteer groups. The PRC received public comment before, at and following the PRC’s July and September 2019 meetings. Comments at the July meeting, which included a range of options for discussion, were fairly evenly split between persons expressing support for the existing policy and those supporting expanded public access. However, public comments largely did not relate to the menu of options discussed for a pilot. The comments from persons speaking against expanding access expressed a general concern about overuse of the Park and potential impacts to the Park’s ecology, and changes to the existing Park experience, with some commenters citing concerns about their personal safety if non-residents are allowed access. Persons speaking in favor of a pilot mentioned their desire for inclusiveness and a sense of being good neighbors, concern about “elitism” and being “embarrassed” by the current policy’s exclusion of non-residents, that the City has lost economic diversity from the time when the residents-only policy was implemented such that the policy has negative effects not present when first implemented, and that a more effective policy could be crafted to ensure preservation of the Park while also allowing public access. During the September 2019 meeting, where the specific pilot program laid out here was presented, two commenters expressed strong support for the pilot, one commenter expressed a preference for allowing access for residents and non-residents only after they go through an orientation to the Park and one commenter noted that the pilot program would require a revision to the existing Municipal Code provision that generally bars non-residents. In addition to studying visitation data and other quantitative measures, staff have begun documenting a baseline for qualitative measurements to aid an assessment of the pilot program.2 1 A more complete discussion of the background and detailed history of the Park is set forth in the Committee’s memo to the PRC in advance of the July 2019 PRC meeting. 2 The qualitative measures include, but are not limited to, the following: (1) level of and frequency of restocking restroom supplies, (2) usage of parking and picnic areas during typical 3 The Committee appreciates the extensive input of past and current leaders within the Community Services Department (“CSD”), particularly the Foothills Park ranger staff, Junior Museum & Zoo staff and the leadership of the Open Spaces, Parks & Golf Division, in developing this pilot program proposal. Details on the Pilot Program Proposal The following pilot program proposal is made in light of the principal comments from the public and staff feedback on implementation and operational considerations: 1.One-year pilot program using extensive historic visitation data to dynamically adjust thenumber of unaccompanied non-residents able to visit the Park. Non-resident passes wouldbe required on all days, with continued staffing of the entry gate on weekends and holidays. 2. Purpose for pilot is to assess quantitative and qualitative impacts to the Park’s ecology, infrastructure and maintenance. As noted above, staff have begun documenting a baselinefor qualitative measurements. Staff will measure and assist in analysis of visitor impactdata. 3. Establish a pass system for non-resident visitors. Up to 50 vehicle/bicycle passes available per day, with staff adjusting number of passes available based on visitation patterns.3 (E.g., busy weekends would have 0-10 non-resident passes available.) a.Non-resident visitors accompanying a Palo Alto resident would still be allowed andwould not need to obtain an online pass, pursuant to current policy. b. Over the course of the pilot, staff will track demand and explore dividing the total number of passes available among non-resident student and volunteer populations and the general public (e.g., 10 passes reserved specifically for non-resident students,10 for non-resident volunteers and the remainder for the general public).4 4. All passes would be available online through the City’s new Parks & Recreationreservation system. The Committee has been advised that staff at Mitchell Park and Lucie Stern Community Centers would be available to assist people with the online reservation system. summer weekends and holidays (including photos), (3) any impacts to the landscape, such as social trails (including photos), (4) notes on any impacts to staff resources, (5) frequency of barbeque cleaning and maintenance, (6) frequency of Greenwaste refuse and recycling pickups, etc. 3 For administrative ease, passes would be for each passenger vehicle or bicycle group. Using the historical average of ~2.7 visitors per vehicle on weekends, 25 passes would equate to approximately 68 visitors and 50 passes would equate to approximately 135 visitors (a lower historic ratio applies for weekdays). A passenger vehicle would be defined as one carrying up to eight people. For persons entering by bicycle or other non-motorized means, one pass would cover also cover eight people. 4 As used in this memo, “students” means preK-12 students, which is a key population to target for access as identified through academic research and community feedback; “volunteer groups” means those organized volunteer organizations that are strategic partners with the Community Services Department (as determined by staff), including but not limited to Grassroots Ecology, Canopy, Environmental Volunteers, etc. 4 5.Formalize and promote City-authorized school field trip programs to the Park, which are presently not anticipated by Municipal Code. The pilot would lift the residency requirementfor co-curricular fieldtrips. Staff are building upon their existing process for centrallycoordinating school/co-curricular and volunteer group reservations to optimize theeducational experience. 6. The existing 1,000 visitor cap would remain in place. Current restrictions on reservation of group spaces would also remain in place (i.e., restricted to residents). 7.$6 fee for non-resident access passes to aid recovery of costs related to current need to staffthe entry gate on weekends and holidays. As part of CSD’s broader fee reduction program,fee waivers would be available through the online portal for targeted groups, including (1)students, (2) persons volunteering with City-supported programs, and (3) persons who certify that they have an economic hardship. Alternative Approaches Considered by the Committee and PRC Before landing upon the proposed pilot, the Committee and PRC considered numerous alternatives, including the following: (a) opening the Park with no visitation limits; (b) shuttle program (e.g., partnering with Stanford’s Marguerite system or another community partner to operate a free weekend shuttle from local libraries/community centers to the Park); (c) visitor orientation program (e.g., allow access to non-residents after participating in an “orientation to the Park”); (d) annual “memberships” for non-residents willing to pay a significant annual fee; (e)student-centric program that extended access to underserved students and their families; (f)taking no action with respect to the existing policy. Each alternative has benefits and drawbacks. On the whole, these alternatives were assessed to be operationally difficult and/or less conducive fora focused pilot program. However, elements of these alternatives may be considered in the futureafter the results of the pilot program are available to better inform those alternatives. Factors Supporting Proposed Pilot a)Effectively mitigates principal concern about overcrowding/overuse of the park. b) Incorporates focus for students and volunteers. c)Addresses public input that policy should be revised to allow reasonable non-residentaccess. d)Allows for experimentation and additional data collection during pilot program on the number of passes available (up to 50 but often fewer), distribution of passes among targeted groups, etc. e)Fees are expected to generate modest revenue that would help offset the cost of staffing theentry gate. f)Good policy: uses robust data to inform the policy and adjust its implementation. Quantitative data will be reinforced by the more qualitative information that ranger staff is developing for a baseline comparison and the information we collect from users via theonline reservation system. 5 Potential Risks As noted previously, the principal risk is that additional visitation will negatively impact Foothills Park’s natural resources and improvements, or otherwise tax park resources. This risk is viewed as a limited one in light of past experience with significantly higher visitation than is anticipated in connection with the pilot program and the effective controls on total visitation that are the core of this pilot. For the pilot program, no capital expenditure is anticipated. Incremental costs may be incurred, including CSD and Foothills Park staff time which may result in reduced staff attention to other projects. Finally, there are certain existing infrastructure needs within the Park (e.g., restrooms that need to be replaced in the next five years), but staff views those as pre-existing needs regardless of this pilot program. For the pilot program, staff have agreed to monitor both overall visitation and pilot-specific visitation to Foothills Park and to work with the Committee to prepare a report and recommendation concerning the pilot program and associated impacts after one year. Recommendation The PRC recommends to the City Council that it direct the City Manager and staff to move forward with the pilot project. To enable the pilot program, the PRC recommends that the City Council amend the Municipal Code as suggested in Enclosure A hereto and adopt any further resolution pursuant thereto. Approved by the Parks and Recreation Commission on November 12, 2019 ENCLOSURE A to PRC Report and Recommendation re: Foothills Park PAMC 22.04.150: Foothills Park shall not be made available for the exclusive use by any persons except for Towle Camp and the Oak Grove Group Area, Pine Gulch Group Area, Wood Fern Group Area, and the Foothills Park Interpretative Center classroom. Foothills Park may be accessible to the general public for the purpose of using the Bay-To-Foothills trails. (a)Only (i) residents of the city and regular or part-time city employees, members of their households related by blood, marriage, or adoption, and their accompanied guests and (ii) such other persons authorized by a specific pilot program approved by resolution of the City Council are entitled to enter on foot or by bicycle or vehicle and remain in Foothills Park. No person who is not a resident of the city may enter on foot or by bicycle or vehicle unaccompanied by a person entitled to enter and remain in Foothills Park for the purpose of using the Bay-To-Foothills trails, except as provided in subsection (b). An "accompanied guest," as used in this section, is one who enters Foothills Park in the presence of a person resident of the city or regular or part-time city employeeentitled to enter and remain in Foothills Park. Each person resident of the city or regular or part-time city employee entitled to enter and remain in Foothills Park may be accompanied by no more than 15 guests, or two vehicles containing no more than 15 guests, at any one time. Upon the request of an authorized city employee or a member of the Palo Alto police department, a person seeking to enter Foothills Park at the main gate or a person within the boundaries of Foothills Park shall provide identification or information to satisfy the requirements of this subsection. The good faith judgment of the authorized city employee or police department member requesting identification or information shall be conclusive as to whether such identification or information provided satisfies the requirements of this subsection. No person shall enter or remain in Foothills Park in violation of this subsection. Violations of this subsection shall be an infraction misdemeanor. (b)Unless otherwise specifically authorized by the director, no person who is a resident of the city shall enter or exit from Foothills Park except through the main gate on Page Mill Road or at designated entry and exit locations on the park boundaries shared with the Enid Pearson Arastradero Preserve and the Los Trancos Open Space Preserve. No person who is a resident of the city shall enter or exit from the Bay-To- Foothills trails in the park except on foot. For the purpose of using the Bay-To-Foothills trails in the park, no person who is not a resident of the city shall enter or exit the park except on foot and at the designated entry and exit locations on the park boundaries shared with the Enid Pearson Arastradero Preserve and the Los Trancos Open Space Preserve. No entry by any person who is not a resident at these designated entry and exit locations on the shared park boundaries shall be permitted by horse or bicycle. Violations of this subsection shall be a misdemeanor. (c)Foothills Park shall be closed from sunset (the actual closure time to be prescribed in park regulations and posted accordingly) until 8:00 a.m. the following morning. No person shall remain in Foothills Park, other than duly authorized city employees and permit holders or participants in city-sponsored activities, during the hours of park closure. Violations of this subsection shall be a misdemeanor. (d)No person shall exceed the maximum speed limit for all vehicles in Foothills Park of twenty miles per hour. Violations of this subsection shall be an infraction. (e)No person shall leave an unauthorized vehicle in Foothills Park after the closing time designated and posted for closing of the park. Violations of this subsection shall be a misdemeanor. (f)No person shall operate a bicycle or a motorcycle except on the paved roads of Foothills Park. No person shall operate a skateboard or roller skates or blades or other coasting device in Foothills Park. This subsection shall not apply to a bicycle or motorcycle operated by a police officer or park ranger acting in the course and scope of his or her duties. Violations of this subsection shall be an infraction. (g)No person shall smoke on any trail in Foothills Park. Violations of this subsection shall be a misdemeanor. (h)No person shall make a wood fire in Foothills Park without a permit. Permits for wood fires within Foothills Park may be issued only for the Towle campfire ring. No person shall start or maintain any charcoal cooking fire within Foothills Park except in city-provided braziers and barbecues in areas so designated and posted. Violations of this subsection shall be a misdemeanor. (i)No person shall shortcut across trail switchbacks. Violations of this subsection shall be an infraction. (j)The city manager shall promulgate regulations for the use of Boronda Lake to protect the users, plants, animals, and structures of the lake. (k)No more than one thousand people shall be permitted in Foothills Park at any one time. (l)No person owning or harboring any dog shall allow or permit such dog to enter or be in Foothills Park on any holiday, as defined in Section 2.08.100(a) of this code, or any Saturday or Sunday. At all other times, no person owning or harboring any dog shall allow or permit such dog, whether licensed or not, to enter or be in Foothills Park except when held under leash by an able-bodied person. Violations of this section shall be an infraction. (Ord. 4865 § 1, 2005: Ord. 4435 § 70, 1997: Ord. 4368 § 2 (part), 1996) 1 of 1 TO: HONORABLE COUNCIL MEMBERS FROM: BETH MINOR, CITY CLERK DATE: COUNCIL MEETING AUGUST 3, 2020 SUBJECT: AGENDA ITEM NUMBER 10- Discuss the Parks and Recreation Commission's Pilot Program to Increase Access to Foothills Park for Non-residents and Provide Direction to Staff (Continued From June 23, 2020) At the July 28, 2020 Parks and Recreation Commission meeting, the Commission hosted a panel discussion to provide different perspectives on opening Foothills Park to non-residents. A recorded video of the discussion can be viewed at https://midpenmedia.org/parks-recreation- commission-34-7282020/. A transcript of the meeting will be available within two weeks. Tonight’s presentation will include a summary of the panel discussion. _______________________ _________________________ Kristen O’Kane Ed Shikada Director, Community Services Department City Manager 10 DocuSign Envelope ID: 2E9C85BE-DE3D-4BBA-BFAA-E4CD1A958B19 City of Palo Alto (ID # 11482) City Council Staff Report Report Type: Action Items Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: PBA 2050 / RHNA Update Title: Update and Discussion on Plan Bay Area 2050 Draft Blueprint and the Regional Housing Needs Allocation Process and Direction to Staff to Prepare Comment Letters on These Regional Efforts From: City Manager Lead Department: Planning and Development Services Recommendation Staff recommends that the City Council take the following actions: 1. Discuss and provide direction to staff as appropriate on two regional planning efforts, which are Plan Bay Area 2050 and the Regional Housing Needs Allocation (RHNA) process; 2. Authorize the Mayor to sign a letter reflecting City Council comments on the Plan Bay Area 2050 Draft Blueprint; and, 3. Direct staff to submit a comment letter to ABAG/MTC’s Housing Methodology Committee reflecting City Council initial comments regarding the Regional Housing Needs Allocation (RHNA) methodology options that are under consideration. Background / Discussion The purpose of this report and agenda item is to update the community and Council on the two subject regional planning initiatives and provide an opportunity for public comment. There was insufficient capacity to schedule this discussion in advance of Council’s summer recess, so an informational report1 was prepared for the June 22, 2020 meeting. The lack of a discussion on this topic before the break raised concerns from some community and Council members interested in advocating the Association of Bay Area Governments (ABAG) appeal the Housing and Community Development (HCD) department’s regional housing needs determination (RHND); the deadline for ABAG to appeal was July 10, 2020. Information on the regional housing needs determination is provided below as well as updates on efforts to develop a methodology that would distribute housing throughout the region. This 1 June 22, 2020 Informational Report: https://www.cityofpaloalto.org/civicax/filebank/documents/77349 City of Palo Alto Page 2 report also includes an update on Plan Bay Area 2050, which has a recently released a draft findings report and is seeking public comment on or before August 10, 2020. Staff prepared a comment letter regarding the Plan Bay Area 2050 Draft Blueprint. A second letter has been prepared to document the City’s initial comments on the RHNA methodology options currently under consideration; this letter would be sent to the ABAG Housing Methodology Committee in advance of their August 13, 2020 meeting. If significant changes are required to either letter, staff recommends the Council authorize the Mayor sign a revised letter consistent with the Council majority’s interests. Both draft letters are included with this report as Attachments A and B respectively. Regional Housing Needs Determination The regional housing needs determination (RHND) represents the number of housing units that must be planned for in a given region over a certain period of time. The state Housing and Community Development (HCD) department makes this determination for all metropolitan planning organizations in California. The Association of Bay Area Governments (ABAG) serves as our MPO and distributes this housing allocation across the nine counties and 101 cities and towns in the Bay Area. For the planning period from 2023 through 2030, the Bay Area was assigned 441,176 housing units, which represents a 16% growth in housing units over the next eight years. These units are distributed among four incomes levels as shown in Table 1 below. HCD develops its forecast based on projected population growth which includes analyzing birth and death rates, and migration. Data for this analysis is collected from the California Department of Finance (DOF). In 2018 the state legislature required HCD to consider additional criteria to respond to the state’s housing crisis and amplify existing policies to affirmatively further fair housing in upcoming housing element cycles. Some of these criteria include adjustments for housing unit replacements, accounting for overcrowding rates, housing cost burden, and target vacancy City of Palo Alto Page 3 rates. These adjustments alone accounted for 217,626 new housing units, or approximately 49% of the RHND of the 441,176 new housing units that HCD sent to ABAG. Future job growth is not an explicit data point factored into HCD’s RHND, however, to the extent net migration reflects future job growth, it represents a relatively small percent of overall population growth. ABAG received the RHND from HCD on June 9, 2020. The ABAG Executive Board reviewed the RHND on June 18, 2020. The ABAG Executive Board declined to appeal the RHND for the nine county Bay Area. Only ABAG has the authority to contest the RHND. The process to contest the RHND is set forth in state law and the ability for ABAG to register an objection on the RHND is limited to two criteria and in its objection, ABAG would have needed to submit a proposed alternative determination of its regional housing need along with documentation substantiating its basis for the alternative determination. Since Plan Bay Area 2050 is well underway and forecasts a larger Bay Area population than projected by HCD, it is unlikely any objection would have resulted in a lower regional housing determination. Furthermore, ABAG staff recommended that the ABAG Executive Board accept the RHND. The Governor and state legislature up to this point have not made any adjustments to the state deadlines2 associated with the upcoming housing cycle and local response to the coronavirus pandemic is not currently a qualifying reason for ABAG to object to or appeal the RHND. Regional Housing Needs Allocation Methodology The Housing Methodology Committee (HMC) is an advisory group consisting of local elected officials, jurisdiction staff, regional stakeholders, and a state partner.3 The HMC is supported by ABAG staff and is tasked with developing a methodology that will distribute the RHND across all counties, cities, and towns within the Bay Area, subject to statutory requirements.4 This 2 The Cities Association of Santa Clara County recently sent a letter to the Governor and the Director of HCD requesting the regional housing needs allocation schedule be modified to give regional jurisdictions and the state adequate time to assess the impact of COVID-19 and ensure the RHNA process achieves HCD’s goals. 3 Housing Methodology Committee Roster: https://abag.ca.gov/sites/default/files/hmc_roster_06_16_2020_0.pdf 4 RHNA Methodology Summary Requirements: • Increasing the housing supply and the mix of housing types, tenure, and affordability in all cities and counties within the region in an equitable manner. • Promoting infill development and socioeconomic equity, the protection of environmental and agricultural resources, the encouragement of efficient development patterns, and the achievement of the region’s greenhouse gas reductions targets. • Promoting an improved intraregional relationship between jobs and housing, including an improved balance between the number of low-wage jobs and the number of housing units affordable to low-wage workers in each jurisdiction. • Allocating a lower proportion of housing need to an income category when a jurisdiction already has a disproportionately high share of households in that income category. City of Palo Alto Page 4 recommendation is forwarded to the Regional Planning Committee, which in turn, will make a recommendation to the ABAG Executive Board. The ABAG Executive Board will decide on its preferred approach to distribute housing units, which must be approved by HCD. Once accepted, an appeal period begins where any jurisdiction within the Bay Area can appeal their own regional housing needs assessment (RHNA), or another jurisdiction’s RHNA allocation. Once a methodology is established, a RHNA number is assigned to each jurisdiction in the region. The RHNA number represents a housing production target at various household income levels that municipalities must proactively plan to accommodate within their jurisdiction. A community’s plan to support future housing growth is set forth in their Housing Element, which is (typically) updated every eight years to coincide with the RHNA process.5 The next HMC meeting will occur on August 13, 2020. At this meeting, the Committee is expected to decide on a baseline that will serve as a starting point for distributing the RHND throughout the Bay Area. One approach being considered is to use 2019 household numbers and increase that number by sixteen percent (16%) for each jurisdiction, which reflects the regional increase generated by the RHND. A second approach being considered is to use the Plan Bay Area 2050 Draft Blueprint as the baseline with its forecasted growth adjusted to coincide with the RHNA cycle; this baseline is also influenced by planning assumptions about where job growth and housing is projected to occur in the future. For Palo Alto, the baseline methodology determination is significant. RHNA Methodology Baseline Data Options6 2019 Household A 4,475 Housing Units Plan Bay Area B 11,130 Housing Units A Source: https://rhna-factors.mtcanalytics.org/option1.html B Source: https://abag.ca.gov/meetings/housing-methodology- committee-2020-jul-09 The baseline data alone, however, may not sufficiently address statutory requirements to distribute housing units in a manner that promotes infill development and socioeconomic equity, address housing fit, jobs/housing balance, or affirmatively further fair housing requirements such as access to high resource and opportunity areas, among other factors. Accordingly, as noted in the June 22, 2020 informational report, the HMC is considering ten factors7 and exploring options to weight those factors in accordance with their mandated objectives. This chart was previously provided and illustrates factor options HMC is evaluating • Affirmatively furthering fair housing. 5 The Housing Element is one of seven mandated elements in a local government’s general or comprehensive plan. 6 Numbers used in this report to illustrate anticipated housing units allocations are approximate and may adjust significantly based on any number of factors until a methodology is adopted. 7 Ten Factors Include: Access to High Opportunity Areas; Divergence Index; Job-Proximity – Auto; Job Proximity – Transit; Vehicle Miles Traveled; Job-Housing Balance; Jobs-Housing Fit; Future Jobs; Transit Connectivity; Natural Hazards. More description regarding these factors is available online: https://rhna- factors.mtcanalytics.org/data/RHNA_tool_factors_overview.pdf City of Palo Alto Page 5 and how they could be weighted (note: at a previous meeting, more Committee members supported the Housing/Jobs Crescent approach, while ‘hazards’ as a factor in the RHNA methodology lost support): Depending on the factors and weights chosen, each jurisdiction’s RHNA number will fluctuate above or below the baseline data set. Much of Palo Alto is identified as either transit rich or high opportunity areas, and Palo Alto has a sizeable jobs/housing imbalance. These characteristics tend to result in more housing units being allocated to Palo Alto. Some factors also influence the percentage of units directed toward lower income units versus market rate units. Another metric the HMC is considering is an income shift multiplier, which is intended to move a jurisdiction’s mix of housing within four income bands in a direction that better reflects the mix of housing throughout the region. Depending on the income shift percentage chosen, a City of Palo Alto Page 6 community with more high income housing units would likely see a greater share of its RHNA allocated toward lower income units and vice versa. The income shift does not result in more housing allocated toward a jurisdiction but reallocates the number of units assigned to each income category. The following chart illustrates this concept. An income shift multiplier of 100 percent results in every jurisdiction’s RHNA mirroring the region’s existing income distribution. In theory, setting the income shift multiplier above 100 percent could close the gap between a jurisdiction’s income distribution and the region’s distribution in a shorter period of time. At their May meeting, HMC members expressed the most support for an income shift multiplier between 100 percent and 150 percent. In contrast to the income shift approach and the methodology options presented above, the HMC is also considering an alternative, standalone methodology referred to as the Bottom-Up concept. This approach uses factors to determine allocations for the four income categories, and the sum of these income group allocations represents a jurisdiction’s total allocation. A jurisdiction’s allocation within each income category is determined based on how the jurisdiction scores relative to the rest of the region on the selected factors. This approach is illustrated in the following diagram: City of Palo Alto Page 7 The HMC considered a two factor approach as well where each factor is weighed at 50%. Depending on the combination of baseline data and factors recommended by the HMC, Palo Alto stands to have a significant increase in market rate and affordable housing units in the upcoming cycle. The range of housing units allocated to Palo Alto is depicted in this chart produced by ABAG staff for the July HMC public meeting: While many in the region may support the higher housing unit targets depicted above, from a staff perspective, the diagram reveals that a Plan Bay Area 2050 Blueprint baseline is not realistic for Palo Alto. The expectation that Palo Alto would increase its housing supply by 55% over the next eight years is clearly unattainable. Accordingly, staff’s draft comment letter to HMC recommends in favor of using the 2019 Household baseline for a future RHNA methodology. The comment letter also highlights concerns staff has regarding unreasonably high housing targets and the implications that may have on communities based on current state law, specifically, SB35. Palo Alto has struggled to produce significant low income housing units, is marginally meeting the market rate target for the current housing cycle, and is well short of the Council’s expressed goal of producing 300+ units each year through 2030. Palo Alto’s access to high paying jobs, excellent schools, proximity to fixed rail and transit, well-established jobs/housing imbalance, disproportionate mix of higher income households and lack of affordable housing for lower wage earners makes this community more susceptible to higher RHNA numbers. Palo Alto will face some difficult choices ahead that will necessarily need to consider community member’s interests regarding parking, floor area, density and height regulations to spur market rate housing or risk losing significant local control over future qualifying housing projects based on SB35. City of Palo Alto Page 8 Senate Bill 35 approved by the state legislature and signed by the governor in 2017 sets forth the requirements for a market rate housing project to qualify for streamlined review, including requiring a certain percentage of on-site affordable units; having at least two-thirds of the floor area dedicated to residential uses; and, workers are paid at a prevailing wage, among other factors. Palo Alto is currently subject to SB35’s streamlining provisions, but to qualify under this law, fifty percent (50%) of the housing units must be deed restricted for low income housing. If the City misses its market rate housing targets after four years in the new housing cycle (or fails to meet it at the end of the current cycle), qualifying market rate housing projects would be subject to a 90 day review period and must be administratively approved; the City could not impose any conditions of approval or deny the project if it meets all objective standards. Moreover, the on-site affordability requirement is reduced from 50% to the 10% (note: in practice, applicants will be subject to the 15% inclusionary requirement in the City’s municipal code). Plan Bay Area 2050 Plan Bay Area 2050 is a 30 year long range planning document for the nine county Bay Area region. This effort is being managed by the Metropolitan Transportation Commission (MTC) and the Association of Bay Area Governments (ABAG) and builds on the Horizon Initiative,8 which sought to explore what living in the Bay Area would be like in 2050 and explored challenges the region it is likely to encounter in the future. Plan Bay Area 2050 will examine a possible future for the Bay Area and is organized into four topic areas: • Housing • Transportation • Economy • Environment The Plan will also need to meet statutory requirements to reduce greenhouse gas emissions as determined by the California Air Resources Board (CARB); accommodate projected household growth; and will ultimately serve as the region’s sustainable communities strategy and regional transportation plan. Federal law further requires the plan be financially constrained and reflect reasonably anticipated transportation revenues during the planning period. Plan Bay Area 2050 sets forth a vision of the Bay Area that is resilient and equitable. The effort is guided by principles supporting affordability, diversity, connectivity, community health and vibrancy – and uses twenty-five (25) strategies organized into nine objectives to model a path forward for the region. 8 More information on the Horizon Initiative is available online: https://mtc.ca.gov/our-work/plans- projects/horizon City of Palo Alto Page 9 These strategies are not binding and require a coordinated effort among local, regional, state governments to achieve the goal. Funding mechanisms are key implementation components of this framework requiring political and in some instances voter approval. Importantly, Plan Bay Area 2050 does not require any changes to local policy documents, comprehensive plans or zoning regulations. Some communities may find they will miss out on future funding opportunities if their local programs are not aligned with the Plan and there is some connection between Plan Bay Area 2050 and how housing units are distributed in the Bay Area through the RHNA process. Draft Blueprint On July 6, 2020, MTC/ABAG released the Plan Bay Area 2050 Draft Blueprint.9 The public comment period ends on August 10, 2020. Staff has reviewed this document and has prepared a comment letter (Attachment B). The letter covers a range of topics, seeking clarification and advocating for positions in the best interest of Palo Altans. For example, several points seek assurance that the inputs to the Blueprint and the model used to create the Blueprint include accurate information and assumptions. The letter identifies and supports strategies that align with Palo Alto policies, such as protecting high-value conservation lands, requiring that 10 to 20 percent of new housing be affordable, and advancing low-cost transit projects. The letter also identifies additional strategies for inclusion and consideration, such as locating jobs in housing-rich areas (such as Alameda County). A chief request, though, is that ABAG/MTC seek relief from the statutory timeline to provide more time for this process. Advancing a long-range planning process at this time does not afford the Bay Area the opportunity to incorporate changes from the COVID-19 pandemic and recession into the long-range plan. For example, the letter suggests that growth in telecommuting could be greater than predicted and may change the location of jobs, housing, and the demand for office space. Furthermore, community members, elected officials, and local staff throughout the Bay Area are consumed by responding to the ongoing crisis. Allowing only 30 days for public process seems insufficient during these times. An extension of time is sorely needed. In addition to the letter, staff outline below upcoming opportunities for City Council members and community members to participate in the Plan Bay Area 2050 process and feedback on the draft Blueprint. Planning and Transportation Commission Review 9 MTC/ABAG City of Palo Alto Page 10 On July 8, 2020, the Palo Alto Planning and Transportation Commission held a study session regarding these two regional planning initiatives.10 Approximately fifteen community members provided public comments during the study session in addition to written comments provided to the PTC as well as the City Council. Commissioners perspectives have been incorporated into the draft letters. As noted above, Commissioners cautioned against the Bottom-Up approach to allocating the RHND. Additional reflections from Commissioners include asking ABAG/MTC to apply more scrutiny to the definition of transit rich, aligning Plan Bay Area 2050 closely with Palo Alto’s goals of climate sustainability and affordable housing development, and addressing the regional jobs-housing imbalance by encouraging greater job development in other parts of the region. Timeline / Public Engagement The following table provides a list of key milestones for Plan Bay Area 2050, RHNA, and forthcoming Housing Element update processes. The public is encouraged to participate in any of the following public engagement opportunities. ABAG 2023 RHNA and Plan Bay Area 2050 Key Milestones11 ABAG 2023 RHNA/Plan Bay Area 2050 Key Milestones Proposed Deadline Plan Bay Area 2050 Draft Blueprint Public Comment Period July 7, 2020 through August 10, 2020 RHNA Housing Methodology Committee Public Comment Period on RHNA Methodology Options Next Meeting: August 13, 2020 Ongoing through Fall 2020 ABAG & Housing Methodology Committee Proposed RHNA Methodology, Draft Subregion Shares Fall 2020 Plan Bay Area 2050 Final Blueprint December 2020 Final Subregion Shares December 2020 Draft RHNA Methodology to HCD for Review Winter 2021 Final RHNA Methodology, Draft Allocation Spring 2021 RHNA Appeals Summer 2021 Final Plan Bay Area 2050 September 2021 Final RHNA Allocation Winter 2021 Housing Element Due Date January 2023 Dates are tentative and subject to change Key Upcoming Meetings for Plan Bay Area 2050 Draft Blueprint: 10 Staff report for Planning and Transportation Commission July 8, 2020 Study Session: https://www.cityofpaloalto.org/civicax/filebank/documents/77546 11 April 27, 2020 Revised RHNA Timeline: https://abag.ca.gov/sites/default/files/abag_rhna_timelineapril.pdf City of Palo Alto Page 11 • July 30, 2020 (1:45PM-3:45PM) Policy Advisory Council Equity & Access Subcommittee: Registration link: https://www.eventbrite.com/e/plan-bay-area-2050-blueprint-workshop- a-focus-on-equity-tickets-113656431446 • August 5, 2020 (11:30AM – 1:30PM) Plan Bay Area 2050 Draft Blueprint Virtual Workshop: Santa Clara County: Registration link: https://bayareametro.zoom.us/webinar/register/WN_VOD7L-qhS- yUVRfuLHrd0g • September 2, 2020 ABAG Regional Planning Committee Meeting Attendance Information: https://mtc.legistar.com/Calendar.aspx • September 11, 2020 Joint MTC Planning Committee with the ABAG Administrative Committee Meeting Attendance Information: https://mtc.legistar.com/Calendar.aspx Key Upcoming Meetings for RHNA: • August 13, 2020 ABAG Regional Housing Needs Allocation (RHNA) Housing Methodology Committee Meeting Attendance Information: https://mtc.legistar.com/Calendar.aspx; https://abag.ca.gov/our- work/housing/rhna-regional-housing-needs-allocation/housing-methodology-committee • September 18, 2020 ABAG Regional Housing Needs Allocation (RHNA) Housing Methodology Committee Meeting Attendance Information: https://mtc.legistar.com/Calendar.aspx; https://abag.ca.gov/our- work/housing/rhna-regional-housing-needs-allocation/housing-methodology-committee Next Steps Following Council’s discussion, staff will finalize the two letters as directed and send them to the appropriate individuals. Staff will continue to attend Plan Bay Area 2050 and HMC meetings and will regularly report back to Council. Discussion items will be scheduled on the Council agenda when direction is needed, or as otherwise directed by the City Council. City of Palo Alto Page 12 Staff encourages interested community members to attend upcoming meetings listed in the table above to share their voice on these topics. Administratively, a recruitment is underway to hire a housing specialist for Palo Alto and a long- range planning professional to support the City’s effort in these and other initiatives. Attachments: • Attachment A: Draft Comments on RHNA Methodology (August 2020) • Attachment B: Draft Plan Bay Area 2050 Comment Letter • Attachment C: Plan Bay Area 2050 Draft Blueprint Documents (July 2020) Date: August 9, 2020 Housing Methodology Committee (HMC) Members, info@bayareametro.gov ABAG Regional Housing Needs Allocation Staff, RHNA@bayareametro.gov Re: City of Palo Alto Initial Comments on 6th Cycle RHNA Methodology Options Thank you, Committee members, for your time, expertise and commitment to designing a methodology that fairly distributes housing in our region. The City of Palo Alto requests that the Housing Methodology Committee recommend use of the 2019 existing households as a baseline allocation for the RHNA methodology and continue its review of an appropriate mix of weighted factors using up to a 150% Income Shift multiplier to distribute new housing units across the region. The alternative baseline approach being considered by the Committee is unattainable for some Bay Area jurisdictions and the imposition of this standard ensures some communities will dramatically fail to meet their housing obligation. While those communities will need to contend with that result, including implications associated with SB35, the risk is also that the region as a whole will produce far less housing than it otherwise could achieve. Plan Bay Area 2050 is a long range plan that requires significant economic investment and an extraordinary amount of regional policy collaboration to implement its vision. Building a methodology today that is actionable over the next eight years and relies on an idealized model depicting a regional housing distribution thirty years from now ignores the reality that the infrastructure, funding and local regulatory framework is simply not yet present to achieve this goal. Palo Alto supports the regional efforts of Plan Bay Area 2050 and commends agency leadership and staff for their tireless work to create a framework for our future. Palo Alto is a partner in this endeavor and recognizes its role to stimulate more housing – especially more equitable and inclusive housing for all. At the same time, Palo Alto cannot reasonably be expected to increase its housing supply by more than 50% over the next eight years, as would be required under some early modeling results that use the Draft Blueprint as a baseline. There will be three and a half regional housing need cycles before the region meets the horizon year of Plan Bay Area 2050. It is imperative that the RHNA methodology be used to shift local policies toward a more inclusive and better balanced future to achieve housing equity and environmental goals. This RHNA methodology needs to bridge where we are today as a region with where we want to go tomorrow. Using the 2019 existing households as a baseline reflects where we are today, shares the responsibility for adding more housing units throughout the region and is consistent with, but not dependent upon Plan Bay Area 2050. Moreover, weighted factors can be used that stretch communities toward our housing, transportation and environmental goals. Thank you for your consideration, Ed Shikada, City Manager [MONTH ##], 2020 RECIPIENT ADDRESS CITY, STATE ZIP Via E-mail to: info@planbayarea.org RE: Comments on Plan Bay Area 2050 Draft Blueprint Dear Chair Arreguin, The City of Palo Alto wants to express gratitude for the exceptional long-range planning work that staff, under the leadership and direction of the Executive Committee, have performed to develop Plan Bay Area 2050, the Draft Blueprint, and other associated reports and documents. The effort aims to ensure that by the year 2050, that the Bay Area is affordable, connected, diverse, healthy, and vibrant for all. As partners in realizing this vision, please accept the following comments on the draft Plan Bay Area 2050 Blueprint: • Request a time extension from appropriate regulatory bodies and statues in order to provide more time to complete Plan Bay Area 2050. While the COVID-19 pandemic has not eliminated the housing crisis in the State or region, the impacts of COVID-19 on population growth and job growth remain to be seen. While working to address the housing crisis is absolutely necessary, conducting long-range planning processes for a thirty-year cycle may be unwise given the unknown impact of COVID-19 on critical variables. A temporary extension of the timeline may provide sufficient time to gather data, for circumstances to change so that the Plan is more useful to the region and to jurisdictions. Furthermore, smaller cities like Palo Alto are reeling from the impacts of COVID-19, which continue to unfold. Insisting the long range planning process unfold unabated is out of sync with the demands the global pandemic has placed on residents, elected leaders, and staff. In this context, 30 days to review and respond to Plan Bay Area 2050 is insufficient. The outreach efforts are extensive, but the time frame is insufficient. • Revise the near term projections and long-term projections to accurately integrate the impacts of COVID-19 into the long-range model. The Horizon Initiative “stress tested” Plan Bay Area strategies against a wide range of external forces and commend the foresight to conduct such a planning exercise, the results of which have informed the Draft Blueprint. The Horizon Initiative, however, falls far short of the type of long-range planning required for a regional response to the pandemic. Failing to specifically integrate the ongoing crisis into the near-term of the forecast is a disservice to the millions of households suffering due to the pandemic. The impact of the current recessionary period will stretch into the next decade, as the Blueprint rightly notes. It is unclear how ABAG/MTC staff draw the conclusion that the effects of the pandemic essentially wear off by 2030 and the region returns to the forecasted growth trend. It is unclear what underlying assumptions lead to this conclusion and whether a traditional recessionary analysis is preferable given we are currently experiencing large- scale, and long-term telecommuting. It is not clear if the assumptions include a foreclosure and/or eviction crisis coupled with massive unemployment and the closure of thousands of small business and the associated elimination of both wealth and livelihoods for many throughout the Bay Area. The interest of Palo Alto isn’t to foretell doom from the pandemic, but rather encourage that long-range regional planning pause to more thoughtfully and collaboratively consider the compound impacts of this crisis--which really is the genesis of several crises. Many Bay Area families and communities may not fully recover from these crises for decades to come. • Update telecommuting projections. Telecommuting may be a long-term impact of COVID-19. Many businesses and institutions are, out of necessity, finding ways to shift operations to completely or mostly remote operations. In particular, large employers have shifted to remote operations. Once the pandemic subsides--which could be as long as two years from its inception— many employers may continue a portion of their operations remotely. The potential is very real that telecommuting could represent a large share of jobs, and thus a reduction in the number of commuters and a shift in where jobs are located. Palo Alto encourages ABAG and MTC to work with CARB to increase the level of telecommuting above 14%. Palo Alto also requests that increased telecommuting be used to forecast shifts in housing demand, decrease in office demand. This adjustment in the model could occur even if 14% needs to be the CARB initiated limit for calculating potential decreases in greenhouse gas emissions. We would like to know how close the Shelter In Place telecommuting levels bring us to meeting the greenhouse gas emission reductions and addressing the regional job/housing imbalance. Further, Palo Alto suggests that increasing telecommuting become a key separate strategy in the Blueprint; it is a strategy the Bay Area can pursue in order to meet our climate action goals and decrease greenhouse gas emissions, which are not currently met by the draft Blueprint. • Revise the Growth Geographies to more accurately represent the accessibility and proximity of transit to adjacent neighborhoods. The Growth Geographies show a ½ mile radius around transit stations and bus stops. While this is meant to indicate an ability to access transit expediently, the reality is that this might not always be the case. These transit-oriented growth geographies may not accurately represent the accessibility of transit in Palo Alto. In many locations, the Caltrain tracks create a physical barrier meaning that a transit stop is not within a ½ mile of a residence, office, or retail location. Furthermore, electrification of the Caltrain system will increase the frequency of train service and diminish the ability of transit users to cross the tracks and access the transit stops. The Growth Geographies must take a more nuanced, user-centered approach to indicating what areas are truly proximate to transit. • Revise and refine the definition of transit rich areas and include a more user-centered view of transit use. The transit-rich growth geographies include proximity to some high-speed and high- capacity transit, such as the Downtown Palo Alto and California Avenue Caltrain stations. The remainder of the Palo Alto Growth Geographies rely on bus service provided by the Valley Transportation Authority. While headways along some of these routes can be 15- minutes or less during peak times, we challenge the inclusion of these bus routes in the definition of transit rich areas. First, the off-peak capacity of these lines do not provide sufficient service to potential residents of housing units along these transit lines. In off-peak times, these residents may still need and/or use vehicles, which will lead to greater greenhouse gas emissions and traffic increases. Secondly, changes to the service may occur. Recently, despite local objection, VTA changed and decreased service to Palo Alto highlighting a concern about the reliability of such service its ability to meet the needs of future car-light residents. • Confirm the accuracy of underlying data used to map Growth Geographies. The City of Palo Alto seeks confirmation in writing that information provided to ABAG and MTC staff has been received and incorporated into the model and mapping for Growth Geographies. This information includes locations and dimensions of historic districts, areas zoned for single-family homes, location of Priority Development Areas, transit services, and other information. In addition, Palo Alto wants to ensure the Growth Geographies in nearby unincorporated Santa Clara County are not part of Palo Alto’s growth geographies. In particular, Palo Alto wants to ensure that newly designated Priority Conservation Areas are taken into account when creating Growth Geographies. A large portion of Palo Alto’s acreage consists of protected open spaces; these areas cannot be envisioned for housing and/or job growth. • Model the office development cap instituted in Palo Alto. Job growth numbers should consider the fact that Palo Alto has adopted restrictions on the annual amount of office growth that can occur in Palo Alto. The purpose of this cap is to decrease the jobs/housing imbalance locally. Communities like Palo Alto and San Francisco that proactively seek to address their jobs/housing imbalance through local policies should not be subjected to projected job growth that is out of synch with local policies. • Explain the distinction and overlap between the methodologies used to create Plan Bay Area 2050 versus the methodologies used by the Department of Finance and the Housing and Community Development Department to generate the regional housing need determination. Department of Finance (DOF) and Housing and Community Development (HCD) prepared projections for population growth and growth in households. Palo Alto staff understand that MTC/ABAG staff also prepared industry/employment, population by age and ethnic characteristics, and household/occupancy/income information for incorporation into the growth forecast for the region and into small area analysis. The Plan Bay Area 2050 Regional Growth Forecast Methodology was presented to the ABAG Executive Board in 2019. At that time the staff memo indicated that further public input would be requested during the 2020 outreach on the Draft Blueprint. However, the latest methodology information was not included in detail at any of three public presentations during the week of July 7, 2020. Toward providing helpful comments on the Draft Blueprint, City staff would appreciate an overview of the aforementioned methodologies used by DOF/HCD and by MTC/ABAG staff and to understand how they are similar or different in their inputs and assumptions. • Palo Alto requests more specific data regarding how ABAG/MTC determined the jobs growth in the plan. With this information, Palo Alto and other jurisdictions can offer more feedback regarding how the job growth projections may be refined. • Explain if or how policies, such as SB 35 Streamlining, were factored into models and methodologies. MTC/ABAG staff included streamlining of housing projects in draft strategy for public consideration in 2019. City staff would like to know how SB35 status or other streamlining was or was not included in methodology assumptions for local jurisdictions. Strategies & Objectives • The City supports inclusion of strategies that move jobs toward housing rich areas. All jurisdictions need to support Bay Area residents with employment diversity and options. By distributing jobs across the Bay Area, the region can decrease commute times, decrease greenhouse gas emissions, and increase the resiliency of jurisdictions. Such distribution strategies could be achieved through office caps in jobs-rich areas, while other jurisdictions might incentivize office and job center development. • The City supports frontloading those strategies that best respond to COVID-19, including those that advance safe bicycle and pedestrian facilities, advance renter protections, advance strategies for childcare which in turn could help essential workers, and advance protecting much-needed open space. The pandemic has made clear the need to address these issues in the near term in order to support households and put the Bay Area back on track for a growing and expanding economy. Transportation • The City of Palo Alto supports the following transportation strategies: o Operate and Maintain the Existing System. o Enable Seamless Mobility with Unified Trip Planning and Fare Payments. o Reform Regional Transit Fare Policy. o Build a Complete Streets Network. o Advance Regional Vision Zero Policy through Street Design and Reduced Speeds. o Advance Low-Cost Transit Projects. Economic • The City of Palo Alto supports the following economic strategies: o Expand Childcare Support for Low-Income Families. o Create Incubator Programs in Economically-Challenged Areas. o Retain Key Industrial Lands through Establishment of Priority Production Areas. Housing • The City of Palo Alto supports the following housing strategies: o Fund Affordable Housing Protection, Preservation, and Production. o Require 10 to 20 Percent of New Housing to be Affordable. Environmental • The City of Palo Alto supports the following environmental strategies: o Adapt to Sea Level Rise. o Modernize Existing Buildings with Seismic, Wildfire, Drought, and Energy Retrofits. o Maintain Urban Growth Boundaries. o Protect High-Value Conservation Lands. o Expand the Climate Initiatives Program. Thank you for your time and attention to these suggestions, comments, and requests for further information. To follow up on and/or respond to the content of this correspondence, please reach out to Jonathan Lait, Director of Planning and Development Services for the City of Palo Alto. You can reach Mr. Lait at Jonathan.Lait@CityofPaloAlto.org or at (650) 329-2679. Sincerely, Adrian Fine Mayor of Palo Alto CC: City Council members Dave Vautin, Assistant Director, Major Plans, Bay Area Metro via DVautin@bayareametro.gov Paul Fassinger, Regional Planning Program, Bay Area Metro, via pfassinger@bayareametro.gov Metropolitan Transportation Commission and the Association of Bay Area Governments Regional Advisory Working Group July 7, 2020 Agenda Item 2 Plan Bay Area 2050 Draft Blueprint: Key Findings Subject: Presentation on the findings from the Draft Blueprint analysis, highlights successes and shortcomings, in advance of stakeholder workshops later this month. Background: Regional Advisory Working Group Agenda Item 2, Plan Bay Area 2050 Draft Blueprint: Key Findings, is attached. This report will be presented to the Joint MTC Planning Committee with the ABAG Administrative Committee on July 10, 2020. Staff will be at your July 7, 2020 meeting to discuss this report. The Working Group’s input is requested. Attachments: Agenda Item 4a from the July 10, 2020 Joint MTC Planning Committee with the ABAG Administrative Committee meeting Metropolitan Transportation Commission and the Association of Bay Area Governments Joint MTC Planning Committee with the ABAG Administrative Committee July 10, 2020 Agenda Item 4a Plan Bay Area 2050 Draft Blueprint: Key Findings Subject: Presentation on the findings from the Draft Blueprint analysis, highlighting successes and shortcomings in advance of stakeholder workshops later this month. Background: Approved for further analysis by MTC and ABAG in February 2020, the Draft Blueprint is the “first draft” of Plan Bay Area 2050, integrating 25 resilient and equitable strategies from the predecessor Horizon initiative. Horizon tested strategies against a wide range of external forces, exploring which policies and investments were best prepared for an uncertain future – from rising telecommute levels to economic boom & bust cycles to consumer preference shifts. The Plan Bay Area 2050 Draft Blueprint weaves together these transportation, housing, economic, and environmental strategies – as highlighted in Attachment B – alongside an expanded set of growth geographies to advance critical climate and equity goals. Designed to accommodate the 1.5 million new homes necessary to house future growth and address overcrowding, as well as 1.4 million new jobs, the Draft Blueprint integrates strategies to address our severe and longstanding housing crisis. With infrastructure investments in walking, biking, and public transportation – as well as sea level protections designed to keep most Bay Area communities from flooding through 2050 – the Draft Blueprint makes meaningful steps towards the adopted Plan Bay Area 2050 Vision. In line with the Plan Vision, this memorandum includes some key highlights as well as key challenges, organized by the five Guiding Principles – to ensure a more affordable, connected, diverse, healthy, and vibrant Bay Area for all. For additional detail on the specific metrics – forecasted outcomes for equity & performance – please refer to Attachment C. Highlights of Draft Blueprint: The Plan Bay Area 2050 Draft Blueprint goes well beyond what was included in the current long-range regional plan, Plan Bay Area 2040. Notable highlights from the analysis conducted over the past four months include: • Improving Affordability for All: For a typical household, the cost burden for housing and transportation as a share of income declines by 9 points between 2015 and 2050. Reductions are even greater for low-income households – a decline of 26 points – with means-based fares and tolls yielding further dividends in advancing equity goals. • Expanding Housing Opportunities for Low-Income Residents. With robust regional measures in play – as well as an expanded inclusionary zoning strategy – the Draft Blueprint includes funding capacity for the construction of over 400,000 permanently-affordable homes through 2050. • Focusing Growth in Walkable, Transit-Rich Communities. The majority of future housing and job growth is located in walkable communities with frequent transit; the Final Blueprint may make further performance gains via additional transit strategies under consideration for the Final Blueprint. Joint MTC Planning Committee with the ABAG Administrative Committee Agenda Item 4a July 10, 2020 Page 2 of 3 • Saving Lives and Protecting Communities. Reduced speed limits and roadway redesigns help play a critical role in saving thousands of lives through 2050, even as more progress is needed to achieve Vision Zero goals. Investments in sea level rise infrastructure saves 98 percent of at-risk homes through 2050, and funding for seismic home retrofits protects 100 percent of homes at high risk of damage. • Positioning the Region for Robust Economic Growth. Despite over $200 billion in new taxes in the decades ahead to pay for the bold strategies approved in February 2020, Bay Area businesses are forecasted to rebound robustly, with per-capita gross regional product soaring by 65% through 2050. Challenges for Final Blueprint: While the Draft Blueprint strategies make meaningful headway on some of the region’s most critical policy issues, five key challenges remain in advancing the bold vision of Plan Bay Area 2050. These challenges will be the focus of our outreach and engagement this summer, as we consider how to make the Blueprint even more resilient and equitable in preparation for an uncertain future: • Challenge #1: Affordable Guiding Principle. While the Draft Blueprint funds a considerable amount of deed-restricted affordable housing, hundreds of thousands of existing low-income residents would still lack a permanently affordable place to live. What strategies could we modify or advance to further increase production of homes affordable to lower-income residents, most importantly in High-Resource Areas with well-resourced schools and convenient access to jobs? • Challenge #2: Connected Guiding Principle. While the Draft Blueprint makes significant headway in improving access for drivers and transit riders compared to existing trends, traffic congestion and transit overcrowding remain significant challenges across the region. How can new or expanded strategies better address these key transportation issues? • Challenge #3: Diverse Guiding Principle. While the Draft Blueprint focuses a sizable share of affordable housing in historically-exclusionary places in the Bay Area, displacement risk continues to rise, especially in Communities of Concern. How can new or expanded strategies reduce this risk of displacement so more residents can remain in place? • Challenge #4: Healthy Guiding Principle. While the Draft Blueprint includes robust protections for agricultural lands and communities vulnerable to sea level rise, the biggest challenge remaining relates to mitigating greenhouse gas emissions (GHG). Given the magnitude of the gap between Draft Blueprint performance and the state-mandated target, what strategies could we modify or expand to close this GHG gap in an equitable and sustainable manner? Joint MTC Planning Committee with the ABAG Administrative Committee Agenda Item 4a July 10, 2020 Page 3 of 3 •Challenge #5: Vibrant Guiding Principle. While Bay Area businesses thrivein the Draft Blueprint, job growth remains relatively concentrated intraditional job centers such as Silicon Valley. Potentially impactful strategiessuch as office development caps were not included in the Draft Blueprintfollowing discussion at the Commission/Board workshop in January, and more modest strategies such as impact fees led to positive yet limited effectsin shifting jobs to housing-rich communities, such as parts of AlamedaCounty. What additional strategies could be considered to shift jobs closer tothe region’s existing workforce? Next Steps: Staff will now seek further input from the public, key stakeholders, and local jurisdiction staff as part of summer 2020 engagement activities. Following a combination of virtual public workshops, telephone town halls, office hours, and non-digital engagement approaches, staff will return to this committee in September with a summary of feedback on Draft Blueprint strategies and outcomes. Staff will also develop potential revisions to the strategies for the Final Blueprint, with anticipated action also slated for September 2020. Following modeling and analysis of the Final Blueprint strategies this fall, MTC and ABAG will select a Preferred Alternative for the Plan Bay Area 2050 EIR by the end of 2020. Recommendation: Information Attachments: Attachment A: Presentation Attachment B: Draft Blueprint – Summary of Strategies (February 2020) Attachment C: Draft Blueprint – Summary of Equity & Performance Outcomes (July 2020) Therese W. McMillan Draft Blueprint: Key Findings July 2020 MTC/ABAG Regional Planning Program Draft Blueprint: Major Milestone for Plan Bay Area 2050 2 2019 20 20 Horizon Public Engagement Horizon Plan Bay Area 2050 Technical Analyses Project Performance JULY 2020 Plan Bay Area 2050 2021 Scenario Planning Futures Final Report Draft Plan Document Policy & Advocacy Perspective Papers Implementation Plan Other Draft Blueprint Final Blueprint Final Plan Document Draft EIR Final EIR Forecast, Needs, Revenues Prep RHNA Proposed Methodology RHNA Draft & Final Methodology RHNA Appeals, etc. = Major Policy Board Decisions The Draft Blueprint is built upon Horizon, which tested visionary strategies for an uncertain future. Horizon explored dozens of bold strategies for the region’s future, “stress testing” them against a broad range of external forces. These included megaregional trends, technological shifts, and natural disasters, among others. 3 Equity Resilience Strategies prioritized based upon: Ultimately, some of the external forces our region may face in the decades ahead make it harder to achieve the regional vision. 4 Cost to drive one mile Market share of autonomous vehicles Share of work from home on typical day Anticipated sea level rise Range Explored in Horizon Futures vs. Plan Bay Area 2050 Draft Blueprint $0.10 per mile $0.40 per mile$0.19 per mile* 10%95%30% share 6%30%14% share (~30% of office workers) Examples of External Forces (2050) 1 foot 3 feet2 feet SLR + flooding Note: MTC/ABAG does not have independent authority to set external force levels for Plan Bay Area 2050. CARB regulates these assumptions in the manner prescribed by SB 375. * MTC/ABAG is specifically seeking a slightly higher auto operating cost from CARB in summer 2020. The Draft Blueprint integrates strategies to make progress towards the regional vision, despite the headwinds from external forces. 5 Vision: Ensure by the year 2050 that the Bay Area is affordable, connected, diverse, healthy and vibrant for all. •Transportation Strategies •Housing Geographies & Strategies •Economic Geographies & Strategies •Environmental Strategies 6 A strategy is either a public policy or set of investments that can be implemented in the Bay Area over the next 30 years; a strategy is not a near-term action or legislative proposal. What do we mean by “strategy”? How many strategies can we include in the Blueprint? Plan Bay Area 2050 must be fiscally constrained, meaning that not every strategy can be integrated into the Plan given finite revenues available. Strategies in Plan Bay Area 2050 can be implemented at the local, regional, or state levels. Specific implementation actions and the role for MTC/ABAG will be identified through a collaborative process for the Implementation Plan later this year. Who would implement these strategies? Refresher: What is a strategy in the context of Plan Bay Area 2050? Picture of Public Outreach Requesting from Graphics 7 3,000 comments at fall 2019 “pop-up” workshops 9,900 comments from Mayor of Bayville online tool 90% of comments at fall 2019 “pop-up” workshops supported the strategies advanced into Plan Bay Area 2050 Blueprint Maintain and Optimize Existing Infrastructure Enhance Regional and Local Transit Create Healthy and Safe Streets Protect, Preserve, and Produce More Affordable Housing Spur Housing Production and Create Inclusive Communities Improve Economic Mobility Shift the Location of Jobs Draft Blueprint: 9 Themes and 25 Bold Strategies Reduce Risks from Hazards Reduce Our Impact on the Environment 25 Strategies (Draft Blueprint Inputs) 8 Refer to Attachment B for details on all 25 strategies in the Draft Blueprint. Draft Blueprint: Highlights in the COVID-19 Era While Plan Bay Area 2050 is a 30-year vision for the Bay Area, many of the strategies approved for analysis by the Commission and ABAG Board in February have only become more timely, including… Advancing thousands of miles of safe bicycle & pedestrian facilities Integrating protections from sudden rent hikes that accelerate displacement Protecting much-needed open space for the enjoyment of all residents Prioritizing strategies for essential workers, such as childcare subsidies HRAs TRAs PDAs PPAs Protect Areas outside Urban Growth Boundaries (including PCAs) Unmitigated High Hazard Areas Priority Development Areas (PDAs) Priority Production Areas (PPAs) Transit-Rich Areas* (TRAs): Frequent Regional Rail High-Resource Areas* (HRAs) * Applies to all jurisdictions except those that have already nominated more than 50% of PDA-eligible areas Prioritize TRAs*: All Other 10Note: some High-Resource Areas are also Transit-Rich Areas Draft Blueprint: Expanded Growth Geographies San Francisco San Jose Santa Rosa Walnut CreekOakland Palo Alto Fairfield Draft Blueprint:New Revenues Required 11 Existing Revenues New Revenues Existing Revenues New Revenues Existing Revenues New Revenues Existing Revenues New Revenues Note: some Transportation Element monies were reserved for Final Blueprint, so not all funds were expended in Draft Blueprint. Note: as no Needs & Revenue work was done for Economy Element, we do not have a baseline accounting of local revenues for economic development. Remaining Needs: $397 billion unfunded need for affordable housing $3 billion in existing funding $50 billion in new revenues N/A in existing funding $33 billion in new revenues $103 billion in existing funding $68 billion in new revenues $463 billion in existing funding $63 billion in new revenues Transportation Element Housing Element Economy Element Environment Element Draft Blueprint: How Did We Analyze It? 12 Strategies & Growth Geographies (February 2020 Approval for Analysis) Economic, Land Use, and Transportation Analysis & Modeling (Spring 2020) Performance Metrics and Growth Pattern (July 2020 Release) Baseline Data (Zoning, Pipeline, Growth Boundaries, etc.) Inputs Inputs Outcomes What are the Potential Outcomes of the Draft Blueprint? (in an uncertain future…) 14 Improved Affordability Housing and transportation costs are significantly reduced, especially for low-income residents. More Permanently-Affordable Homes New revenues enable a significant uptick in production of deed-restricted affordable homes. More Growth Near Transit Most new homes are focused in walkable communities with frequent transit service. Draft Blueprint Highlights (1 of 2) 57%48% in 2015 in 2050 % of household income spent on housing + transportation % of all housing within ½ mile of high-frequency transit 32%43% in 2015 in 2050 number of new permanently- affordable homes 400,000+ by 2050 15 Lives Saved and Injuries Averted Strategies to reduce vehicle speeds and build protected bike/ped infrastructure save lives. Greater Resilience to Hazards Seismic retrofits and sea level rise infrastructure protect thousands of homes from damage. Robust Economic Growth Despite significant tax increases to pay for new strategies, Bay Area businesses continue to thrive. Draft Blueprint Highlights (2 of 2) >1,500 through 2050 fatalities avoided due to Draft Blueprint strategies % of homes at risk protected growth in gross regional product per capita (constant $) +65% by 2050 100% from quake 98% from SLR The Draft Blueprint accommodates the needs of future residents by addressing historical underproduction of housing. 7.7 4.0 2.7 2.7 10.3 5.4 4.0 4.3 Population Employment Households Housing Units 2015 2020 2025 2030 2035 2040 2045 2050 Year 16 in millions +2.7 million 2015 to 2050 in millions +1.4 million 2015 to 2050 in millions +1.4 million 2015 to 2050 in millions +1.5 million 2015 to 2050 Regional Growth Forecast: Bay Area Integrating COVID-19/Recession Impacts between 2020 and 2030 Figures may not appear to exactly sum due to rounding. Draft Blueprint: Housing Growth Pattern 17 Plan Bay Area 2040: 2010 to 2040 +0.8 million new households Draft Blueprint: 2015 to 2050 +1.3 million new households 31% 17% 7% 23% 12% 3% 4% 1% 1% 41% 10% 10% 19% 8% 3% 6% 2% 1% KEY GROWTH STATISTICS 46% in Big 3 Cities 33% in Bayside Cities 21% in Inland/Coastal/Delta 77% in Priority Development Areas 61% in Transit-Rich Areas 22% in High-Resource Areas For breakdowns on the subcounty level, please refer to Attachment C. Totals do not always sum to 100% due to rounding. County’s share of regional growth, sized based upon total number of new households MAP LEGEND X% KEY GROWTH STATISTICS 41% in Big 3 Cities 37% in Bayside Cities 22% in Inland/Coastal/Delta 70% in Priority Development Areas 70% in Transit-Rich Areas 29% in High-Resource Areas County’s share of regional growth, sized based upon total number of new households MAP LEGEND X% Draft Blueprint: Jobs Growth Pattern Plan Bay Area 2040: 2010 to 2040 +1.3 million new jobs Draft Blueprint: 2015 to 2050 +1.4 million new jobs 30% 23% 10% 19% 11% 1% 1% 44% 13% 19% 8% 2% 0% 18 2% 3% 3% KEY GROWTH STATISTICS 44% in Big 3 Cities 40% in Bayside Cities 17% in Inland/Coastal/Delta 55% in Priority Development Areas 59% in Transit-Rich Areas 25% in High-Resource Areas County’s share of regional growth, sized based upon total number of new jobs MAP LEGEND X% KEY GROWTH STATISTICS 49% in Big 3 Cities 35% in Bayside Cities 16% in Inland/Coastal/Delta 42% in Priority Development Areas 50% in Transit-Rich Areas 19% in High-Resource Areas County’s share of regional growth, sized based upon total number of new jobs MAP LEGEND X% For breakdowns on the subcounty level, please refer to Attachment C. Totals do not always sum to 100% due to rounding. 10% 3% Draft Blueprint: Commute Mode Choices 19 19 75% Auto 14% Transit 5% Walk + Bike 6% Work from Home 58% Auto 20% Transit 8% Walk + Bike 14% Work from Home 2015 2050 Blueprint Draft Blueprint: Sea Level Rise Protections 20 Plan Bay Area 2050: 2015 to 2050 +89,000 housing units protected 89,000 units protected 98% 100%97% 91% 94% 100% 94% Circles and percentages show where housing units are protected by the sea level rise strategy. Circle size represents the number of units protected. 70% 100% All major highway and rail corridors protected at 2 feet of sea level riseTransportation Environment Housing 100,000 acres of marsh adaptation projects 166,000 jobs protected 10,000 jobs still at risk Jobs 2,000 units still at risk -4%* PBA40 21 -15% Plan Bay Area 2040 -15% per-capita Previous CARB Target -19% per-cap. New Target Updated Assumptions -15% Remaining Gap Previous Assumptions Updated Assumptions Low cost to drive Moderate cost to drive -10% Remaining Gap -9% Draft Blueprint Updated Assumptions Low cost to drive -7% Remaining Gap -12%* Draft Blueprint Updated Assumptions Moderate cost to drive * = approximated effect of higher auto operating cost based upon past analyses -18% Remaining Gap Draft Blueprint: GHG -1% PBA40 How Does the Draft Blueprint Align with Guiding Principles? Overarching Finding: The Draft Blueprint strategies excel in ensuring future growth is more equitable and resilient than past generations. However, righting the wrongs of the 20th century would require even bolder action. Staff developed 10 evaluation questions -two for each Guiding Principle -based upon feedback from stakeholder workshops in fall 2019 and winter 2020. Evaluating the Draft Blueprint Refer to Attachment C for all the metrics, including breakdowns by income level. •Will Bay Area residents spend less on housing and transportation? •Will the Bay Area produce and preserve more affordable housing? •Will Bay Area residents be able to access their destinations more easily? •Will Bay Area residents have a transportation system they can rely on? •Will Bay Area communities be more inclusive? •Will Bay Area residents be able to stay in place? •Will Bay Area residents be healthier and safer? •Will the environment of the Bay Area be healthier and safer? •Will jobs and housing in the Bay Area be more evenly distributed? •Will Bay Area businesses thrive? •Will Bay Area residents spend less on housing and transportation? Yes, with greater reductions for lower-income households. •This will be the first Plan Bay Area that actually reduces housing cost burden, especially for lower-income households. •Means-based tolls are effective in mitigating most equity impacts, whereas means-based fares lead to cost burden reductions for low- income transit riders. •Will the Bay Area produce and preserve more affordable housing? Yes, but it remains short of existing regional needs. •The Draft Blueprint has sufficient funding to permanently protect existing deed-restricted units and to produce approximately enough new units for all low-income household growth through 2050. 25 Key Findings: A More Affordable Bay Area Key Challenge for Final Blueprint: How do we further increase production of homes affordable to lower-income residents, especially in High-Resource Areas? •Will Bay Area residents be able to access their destinations more easily? Yes for transit, no for auto. •Access to jobs improves for public transit, particularly in Communities of Concern, thanks to bus and BART investments in the Draft Blueprint. •Rising traffic congestion, combined with reduced speed limits, play a role in reducing automobile access to destinations. •Will Bay Area residents have a transportation system they can rely on? Depends on the highway corridor and transit operator. •Means-based tolls help reduce congestion on key corridors, but toll rates are insufficient to mitigate all impacts of a growing population. •While the New Transbay Rail Crossing addresses Transbay capacity constraints, transit crowding challenges continue to grow elsewhere, especially on express buses and rail systems. 26 Key Findings: A More Connected Bay Area Key Challenge for Final Blueprint: How can new or expanded strategies better address traffic congestion and transit overcrowding? •Will Bay Area communities be more inclusive? Only High-Resource Areas become more inclusive. •Reducing barriers to housing production in High-Resource Areas allows for an increase in the amount of deed-restricted affordable housing in historically-exclusive areas. •However, many Transit-Rich Areas are at risk of gentrification, as the Blueprint forecasts an increasingly wealthy demographic profile. •Will Bay Area residents be able to stay in place? Not over the long-term without further mitigations. •Low-income residents continue to be at a high risk of displacement, especially in Communities of Concern; robust renter protections do not provide meaningful long-term relief. 27 Key Findings: A More Diverse Bay Area Key Challenge for Final Blueprint: How can we reduce risk of displacement so more residents can remain in place? •Will Bay Area residents be healthier and safer? Yes, but more gains are needed for road safety. •Nearly all homes at risk of sea level rise are protected by Draft Blueprint resilience investments. •While reduced speed limits save more than 1,500 lives through 2050, expanded strategies would be required to reach Vision Zero. •Will the environment of the Bay Area be healthier and safer? Yes, but more reductions are needed for greenhouse gas emissions (GHG). •While the Draft Blueprint strategies make significant headway, a concerted effort in the Final Blueprint will be necessary if the Bay Area intends to close the sizeable remaining gap. 28 Key Findings: A Healthier Bay Area Key Challenge for Final Blueprint: How do we close the greenhouse gas emissions gap in a sustainable and equitable manner? •Will jobs and housing be more balanced? It depends. •Higher-income jobs continue to cluster in Silicon Valley, even as workers may choose to work from home multiple days per week. •While job centers like San Francisco and Silicon Valley become more balanced, housing-rich communities in the East Bay and North Bay see more limited job growth. •Will Bay Area businesses thrive? Yes, select industries are anticipated to see robust growth. •The Bay Area economy is projected to rebound robustly in the decades ahead; additional tax measures enable some of these gains to more equitably shared by all Bay Area residents. 29 Key Findings: A More Vibrant Bay Area Key Challenge for Final Blueprint: How could more ambitious strategies be employed to shift jobs closer to the region’s workforce? How do we further increase production of homes affordable to lower-income residents, especially in High-Resource Areas? How can new or expanded strategies better address traffic congestion and transit overcrowding? How can we reduce risk of displacement so more residents can remain in place? How do we close the greenhouse gas emissions gap in a sustainable and equitable manner? How could more ambitious strategies be employed to shift jobs closer to the region’s workforce? 5 Key Challenges for Final Blueprint -Seeking Solutions! A larger regional measure for affordable housing? More strategic investment in High-Resource Areas? New strategies related to regional rail & express bus? More funding for bike & pedestrian infrastructure? Redesign transit system with key timed transfers? Supportive services in Communities of Concern? 50% telecommute mandate for big employers? Exponentially grow regional subsidies for EVs? Require GHG offsets for all highway projects? Office development caps in West & South Bay? Expand jobs- housing impact fees? Expanded affordability requirements in new TODs? More affordable housing in Transit-Rich Areas? Reform on-and off-street parking policies? More corridors with means- based all-lane tolling? Workforce training programs? Tax subsidies to woo major employers? Support for modular housing and lower-cost techniques? Pilot universal basic income? 30 31 Listening and Learning from CBO Focus Groups Time transfers so they actually work for people, especially those with disabilities! There are barriers to applying for housing, such as having a criminal record. This is not just about jobs but about what kind of jobs. Any greening of the community will cause gentrification and displacement. 10 to 20 percent affordable housing is simply not sufficient. Highlighted Quotes from Spring 2020 Listening Sessions on Draft Blueprint A more comprehensive report on Public Engagement activities is slated for September 2020. Transitioning to the Final Blueprint Phase: Seeking Input from the Bay Area! 33 9 county-specific virtual public workshops 5 telephone town halls Also: •Office hours •Flyers/surveys •Listening line •Official comment period •Statistically-valid poll 3 virtual stakeholder workshops 7 focus groups in community organizations Upcoming Summer 2020 Blueprint Engagement Looking for Input: How can we address these remaining challenges in the Final Blueprint? 34 Final Blueprint Modify strategy Add strategy Remove strategy •We look forward to getting input from elected officials, the public, and stakeholder organizations on equitable and resilient strategies to advance the Plan Vision of an affordable, connected, diverse, healthy, and vibrant Bay Area. •We’ve already started this process with the Transportation Element -projects with performance challenges were identified early and project sponsors have made commitments to address many of them. Work on this strand continues through September -but transportation projects are just one small piece of the puzzle. What’s Next? •Release of Draft Blueprint •Virtual Workshops & EngagementJuly •Close of Blueprint Comment Period •Strategy Refinements for Final BlueprintMid-August •Report Out on Public & Stakeholder Engagement •MTC/ABAG Action on Final Blueprint Strategies & GeographiesSeptember •Release of Final Blueprint •MTC/ABAG Action on Preferred Alternative for Plan Bay Area 2050 EIRDecember 35 Questions/Comments? For more information: refer to Attachments B and C in your packet or go to planbayarea.org. Contact info: Dave Vautin, dvautin@bayareametro.gov 36 Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov HELP US DRAFT THE BLUEPRINT. WHAT IS THE PLAN? Plan Bay Area 2050 is the long-range plan now being developed by the Metropolitan Transportation Commission and the Association of Bay Area Governments to guide the growth of our nine-county region for the next generation. Scheduled for completion in 2021, the Plan will integrate strategies for transportation, housing, the environment and the economy and lead the Bay Area toward a future that is affordable, connected, diverse, healthy, and vibrant for all by 2050. DRAFTING THE BLUEPRINT WHAT IS THE DRAFT BLUEPRINT? WHAT IS A “STRATEGY”?WHO IMPLEMENTS THESE STRATEGIES? Creating the Blueprint is the first step toward developing Plan Bay Area 2050. The Draft Blueprint integrates 25 equitable and resilient proposed strategies from the Horizon initiative and offers bold solutions to address nine primary objectives across key areas including: transportation, housing, the environment and the economy. A strategy is either a public policy or set of investments that can be implemented in the Bay Area over the next 30 years. A strategy is not a near- term action, a mandate for a jurisdiction or agency, or a legislative proposal. In addition, because Plan Bay Area 2050 must be fiscally constrained, not every strategy can be integrated into the Plan given finite available revenues. Strategies in Plan Bay Area 2050 can be implemented at the local, regional, or state levels. Specific implementation actions and the role for MTC/ABAG will be identified through a collaborative process for the Implementation Plan in late 2020. See inside to learn more about the Draft Blueprint’s objectives and proposed strategies. WHAT REQUIREMENTS MUST THE PLAN MEET? Among many statutory requirements, the Plan must be fiscally constrained and rely on reasonably expected revenues; it must meet or exceed a 19 percent per-capita GHG reduction target for light-duty vehicles by 2035; and it must plan for sufficient housing at all income levels. WHAT ABOUT PUBLIC INPUT? WHAT’S NEXT? In addition to robust analysis conducted as part of the Horizon initiative and ongoing feedback from elected officials, thousands of comments from Bay Area residents and stakeholders helped define and refine the 25 proposed Blueprint strategies. Staff will now conduct a detailed analysis and report back on outcomes from the Draft Blueprint strategies this spring. Planned public engagement will provide additional opportunities for strategies and projects to be revised and integrated into the Final Blueprint, with the Final Blueprint scheduled for completion later in 2020. Attachment B Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov DRAFT BLUEPRINT STRATEGIES OBJECTIVES TRANSPORTATION STRATEGIES 2. Create Healthy and Safe Streets Build a Complete Streets Network. Enhance streets to promote walking, biking, and other micromobility through sidewalk improvements and 7,000 miles of bike lanes or multi-use paths. Advance Regional Vision Zero Policy through Street Design and Reduced Speeds. Reduce speed limits to 25 to 35 miles per hour on local streets and 55 miles per hour on freeways, relying on design elements on local streets and automated speed enforcement on freeways. 1. Maintain and Optimize Existing Infrastructure Operate and Maintain the Existing System. Commit to operate and maintain the Bay Area’s roads and transit infrastructure, while ensuring that all Priority Development Areas have sufficient transit service levels. Enable Seamless Mobility with Unified Trip Planning and Fare Payments. Develop a unified platform for trip planning and fare payment to enable more seamless journeys. Reform Regional Transit Fare Policy. Streamline fare payment and replace existing operator- specific discounted fare programs with an integrated fare structure across all transit operators. Implement Per-Mile Tolling on Congested Freeways with Transit Alternatives. Apply a per-mile charge on auto travel on select highly-congested freeway corridors where transit alternatives exist, with discounts for carpoolers, low-income residents, and off-peak travel, with excess revenues reinvested into transit alternatives in the corridor. 3. Enhance Regional and Local Transit Advance Low-Cost Transit Projects. Complete a limited set of transit projects that performed well in multiple futures and require limited regional dollars to reach fully-funded status. Build a New Transbay Rail Crossing. Address overcrowded conditions during peak commute periods and add system redundancy by adding a new Transbay rail crossing connecting the East Bay and San Francisco. 5. Shift the Location of Jobs Allow Greater Commercial Densities in Growth Geographies. Allow greater densities for new commercial development in select Priority Development Areas and select Transit-Rich Areas to encourage more jobs to locate near public transit. Assess Transportation Impact Fees on New Office Developments. Apply expanded county- specific fees on new office development that reflects associated transportation impacts. Assess Jobs-Housing Imbalance Fees on New Office Developments. Apply a regional jobs- housing linkage fee to generate funding for affordable housing when new office development occurs in job-rich places, thereby incentivizing more jobs to locate in housing-rich places. OBJECTIVES ECONOMIC STRATEGIES 4. Improve Economic Mobility Expand Childcare Support for Low-Income Families. Provide a 50 percent childcare subsidy to low-income households with children under 5, enabling more parents with young children to remain in (or to enter) the workforce. Create Incubator Programs in Economically-Challenged Areas. Fund pre-incubation services or technical assistance for establishing a new business, as well as access to workspaces, and mentorship and financing in disadvantaged communities. Retain Key Industrial Lands through Establishment of Priority Production Areas. Implement local land use policies to protect key industrial lands identified as Priority Production Areas, including preservation of industrial zoning. Attachment B Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov DRAFTING THE BLUEPRINT OBJECTIVES HOUSING STRATEGIES 6. Spur HousingProduction andCreate InclusiveCommunities Allow a Greater Mix of Housing Types and Densities in Growth Areas. Allow a variety of housing types at a range of densities to be built in Priority Development Areas, select Transit-Rich Areas, and select High-Resource Areas. Reduce Barriers to Housing Near Transit and in Areas of High Opportunity. Reduce parking requirements, project review times, and impact fees for new housing in Transit- Rich and High-Resource Areas, while providing projects exceeding inclusionary zoning minimums even greater benefits. Transform Aging Malls and Office Parks into Neighborhoods. Transform aging malls and office parks into mixed-income neighborhoods by permitting new land uses and significantly reducing development costs for eligible projects. 7. Protect, Preserve, and Produce More Affordable Housing Fund Affordable Housing Protection, Preservation and Production. Raise an additional $1.5 billion in new annual revenues to leverage federal, state, and local sources to protect, preserve and produce deed-restricted affordable housing. Require 10 to 20 Percent of New Housing to be Affordable. Require at least 10 percent to 20 percent of new housing developments of 5 units or more to be affordable to low-income households, with the threshold defined by market feasibility as well as access to opportunity and public transit. Further Strengthen Renter Protections Beyond State Legislation. Building upon recent tenant protection laws, limit annual rent increases to the rate of inflation, while exempting units less than 10 years old. OBJECTIVES ENVIRONMENTAL STRATEGIES 8. Reduce Risks from Hazards Adapt to Sea Level Rise. Protect shoreline communities affected by sea level rise, prioritizing areas of low costs and high benefits and providing additional support to vulnerable populations. Modernize Existing Buildings with Seismic, Wildfire, Drought, and Energy Retrofits. Adopt new building ordinances and incentivize retrofits to bring existing buildings up to higher seismic, wildfire, water and energy standards, providing means-based subsidies to offset impacts. 9. Reduce Our Impact on the Environment Maintain Urban Growth Boundaries. Using urban growth boundaries and other existing environmental protections, confine new development within areas of existing development or areas otherwise suitable for growth, as established by local jurisdictions. Protect High-Value Conservation Lands. Provide strategic matching funds to help conserve high-priority natural and agricultural lands, including but not limited to Priority Conservation Areas. Expand the Climate Initiatives Program. Expand MTC’s Climate Initiatives Program, which includes investments in transportation demand management and electrification incentive programs, while simultaneously working with the Air District and the State to reduce greenhouse gas emissions for other transportation sectors. Attachment B Agenda Item 4a @MTCBATA MTCBATA @mtcbata #BayArea2050 TELL US WHAT YOU THINK! ADVANCING EQUITY WITH BOLD STRATEGIES Consistent regional means-based discounts for fares and tolls. Service frequency increases in both high-ridership corridors and in currently-undeserved PDAs. Emphasis on growth in High- Resource Areas to address the legacy of race-based exclusion. Prioritization of retrofit assistance and sea level rise infrastructure in lower-income communities. Incubator programs and childcare support designed to enable greater economic mobility. WINTERFALLSUMMERSPRING • Release Draft Blueprint Outcomes and Growth Pattern • Revise Strategies for Final Blueprint • Stakeholder and Public Workshops • Adopt Final Blueprint • Advance to Environmental Impact Report (EIR) • Environment Analysis MTC and ABAG will hold public workshops all around the Bay Area later in 2020 and invite you to help shape the Plan Bay Area 2050 Blueprint. We want to find out what you – and your family, friends, and neighbors – have to say about the 25 proposed strategies and how these strategies could influence the way we will live, work and travel in the Bay Area over the next generation. MTC and the ABAG Executive Board are scheduled to adopt a Final Blueprint in fall 2020. We look forward to hearing from you! Visit planbayarea.org to learn more or to check the schedule of public workshops. You can also follow MTC BATA on social media. As a cross-cutting issue of Plan Bay Area 2050, staff has worked to weave equity into every single strategy for the Draft Blueprint. Attachment B Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov Strategy Funding Share of Total Topic Area Investment Expand Childcare Support $30 Create Job Incubator Programs $3 9% 91% EC O N O M Y $33 B Fund Af fordable Housing Production $166 Fund Af fordable Housing Preservation $2 Fund Af fordable Housing Protection $3 97% 1% 2%HO U S I N G $ 17 1 B Adapt to Sea Level Rise (SLR)$17 Retrofit Existing Buildings $20 Protect High-Value Conservation Lands $15 Expand Climate Initiatives Program $1 32% 38% 28% 2%EN V I R O N M E N T $53 B Maintain Existing System $392 Optimize System: Transit Fare Policy Reform $10 Optimize System: Seamless Mobility $0.1 Optimize System: Freeway Tolling $1 Safe Streets: Complete Streets Network $7 Safe Streets: Regional Vision Zero Policy $1 Projects: Low-Cost High-Performing Transit $20 Projects: New Transbay Rail Crossing $29 (Not in Dra) Projects: Other Regional Priorities $22 75% 2% .2% .2% 1% .2% 4% 6% 4% TR A N S P O R T A T I O N $52 6 B (Not in Dra) Projects: County Priorities $44 8% To p i c A r e a a n d T o t a l A n t i c i p a t e d R e v e n u e s ( $ 783B) Funding Share of Total TopicArea InvestmentStrategy Key Metrics Share of Housing Production Funding, by Area Type High-Resource Areas 75% Transit-Rich Areas 76% Communities of Concern 26% HELP US DRAFT THE BLUEPRINT. The Plan Bay Area 2050 Draft Blueprint is a package of 25 transformational strategies that aim to make the Bay Area more affordable, connected, diverse, healthy and vibrant for all. Strategies are either public policies or packages of investments that could be advanced on the local, regional or state levels. This document describes the outcomes of the Draft Blueprint based upon the strategies approved by the MTC and ABAG Boards in February (refer to strategies document for more information). EQUITY AND PERFORMANCE OUTCOMESDRAFTING THE BLUEPRINT What Does This Document Include?Key Definitions in Metrics 1 | How Does the Draft Blueprint Allocate Anticipated Revenues Toward Strategies? 2 | How Does the Draft Blueprint Influence the Regional Growth Pattern? 3 | What are the Key Equity and Performance Outcomes of the Draft Blueprint? 4 | What are the Key Takeaways from the Draft Blueprint? 5 | How Did We Analyze the Draft Blueprint? 6 | What's Next, COVID-19 Impacts on Final Blueprint, and How You Can Get Involved 2015 Refers to modeled 2015 conditions, which were calibrated to closely match on-the-ground conditions. 2050 Trend Reflects the 2050 outcomes if population and job growth continue according to the Plan Bay Area 2050 Growth Forecast and all Draft Blueprint land use strategies are implemented, without any changes to the transportation system (only available for transportation metrics). 2050 Blueprint Reflects 2050 outcomes with all 25 Draft Blueprint strategies. LIHH Low-Income Households with household incomes less than $45,000 in today’s dollars; shown where feasible to parse out equity impacts. CoCs Communities of Concern; updated using latest ACS data. High-Resource Areas State-designated areas with access to well-resourced schools, open space, jobs and services. Transit-Rich Areas Areas within 1/2 mile of a rail station, ferry terminal or frequent bus stop (every 15 minutes or less) consistent with MTC/ABAG- adopted criteria. Priority Production Areas Industrial districts that support industries that are critical to the functioning of the Bay Area economy and are home to “middle wage” jobs. 1 | How Does the Draft Blueprint Assign Anticipated Revenues Toward Strategies? The Draft Blueprint anticipates total inflation-adjusted revenues of $783 billion across four topic areas of Transportation, Housing, Economy and Environment during the Plan period from 2021 to 2050, integrating the impacts of the COVID-19 recession as well as future regional revenue measures. The chart below highlights how these revenues are assigned among various strategies. Zero-cost strategies (e.g., increased development capacity for housing) that do not require significant financial investment are not shown. On the right, key metrics help characterize the investments. NOTE: There is a $66 billion reserve in the Transportation Element for Final Blueprint strategies not included in the Draft Blueprint; this reserve can help fund other county and regional priorities like Express Lanes and commuter rail lines. Annual Subsidy per Low-Income Households Childcare Support $10K Job Incubator Programs $1K Funding by Mode: Maintain System Transit 70% Road/Bike/Ped 30% Funding by Mode: All Other Strategies Transit 79% Road 4% Bike/Ped 17% Benefits for Low-Income Households Share of Population 24% Share of Road Funding 27% Share of Transit Funding 44% Benefits for Minorities Share of Population 60% Share of Road Funding 52% Share of Transit Funding 63% Share of Funding in Communities of Concern* Adapt to Sea Level Rise 25% Retrofit Existing Buildings 15% * Environment investment in Communities of Concern is fully sufficient to meet identified needs. Attachment C Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov 2 | How Does the Draft Blueprint Influence the Regional Growth Pattern? The nine-county Bay Area is divided into 34 subcounty areas, called “superdistricts.” Superdistricts are combinations of cities, towns and unincorporated areas that allow the public to see the more localized growth pattern in Plan Bay Area 2050. More information on the superdistricts can be found in the layer documentation. 6.1 4.6 Jobs/Housing Ratio 6.1 4.6 Jobs/Housing Ratio 0.6 0.6 0.9 0.9 0.9 0.9 0.9 0.9 0.91.0 1.0 1.0 1.0 1.4 1.5 1.5 1.5 1.5 1.4 1.21.2 1.4 1.6 0.70.8 3.0 0.7 0.7 1.2 1.14.60.8 2.10.6 0.6 1.0 0.7 1.2 1.0 0.9 1.1 1.1 0.81.1 0.8 1.2 1.4 1.2 1.3 1.3 1.9 1.2 1.7 1.62.2 1.3 1.7 0.71.1 3.5 3.03.5 1.3 0.9 1.2 1.56.10.8 2.50.6 4.60.8 2.10.6 6.10.8 2.50.6 0.0 70.0 Persons/Acre,urbanized area only 0.0 70.0 Persons/Acre,urbanized area only 2.2 13.0 0.2 2.3 1.0 0.7 3.5 1.5 2.42.2 3.2 3.5 0.3 0.1 1.4 3.3 4.8 1.1 25.75.9 6.6 1.7 7.76.6 10.7 0.6 2.4 13.0 17.367.831.0 38.424.7 67.831.0 38.424.7 19.729.4 27.1 16.0 22.9 1.9 7.8 0.1 1.5 0.9 0.6 2.9 1.4 2.31.7 2.7 3.0 0.2 0.1 1.3 3.1 4.5 0.8 14.24.0 4.9 1.4 6.24.3 5.6 0.5 2.3 8.4 11.949.329.4 27.122.9 49.3 5% 5%6%6% 7% 8%30%30% 2% 2%2% 2% 3% 3%3% 4% 1% 1% 1% 1% 1% 1% 1%1% 1% 1% 1% 1% -1% 0% 0% 0%0% 0% 0% Total Growth 2015 to 2050 +1.4m Jobs Job Growth between 2015-2050 (as a Share of Region’s Growth) Population Density 2050 (Region-Wide Average: 2.2) Jobs/Housing Ratio 2050 (Region-Wide Average: 1.34) 7% 8% 9%9% 12% 3% 3% 4% 4% 4% 6% 6% 3% 5% 2% 2% 2% 2% 2% 2% 2% 2% 1% 1% 1% 0% 1%1% 1%1%1% 1% 1% 1% 1% Total Growth 2015 to 2050 +1.3m Households Housing Growth between 2015-2050 (as a Share of Region’s Growth) Population Density 2015 (Region-Wide Average: 1.7) Jobs/Housing Ratio 2015 (Region-Wide Average: 1.50) Attachment C Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION? In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable. H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINT Low-Income Households (LIHH)109%86%83% All Households 57%48%48% Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINT Average Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60 All Households $3.16 $3.41 $2.96 Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11 All Households $1.26 $1.45 $1.53 Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10 All Households $0.08 $0.12 $0.21 WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING? 28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High- Resource Areas due to strategic investments in these locations. SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28% High-Resource Areas 37% The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes. SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100% WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY? The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend. (Metric under development for Final Blueprint: Accessibility to Community Places) PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINT By Car within30 Minutes CoC Residents 19.2%13.6%14.4% All Residents 17.8%12.2%12.6% By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2% All Residents 3.4%4.3%4.7% By Bike within20 Minutes CoC Residents 2.9%3.5%3.5% All Residents 2.3%2.8%2.8% By Foot within20 Minutes CoC Residents 0.3%0.4%0.4% All Residents 0.2%0.2%0.2% SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINT More households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46% All Households 32%43% Jobs Manufacturing/Warehouse/Utilities 45%43% All Jobs 52%52% WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON? Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times. PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINT Most of Route Features All-Lane Tolling (>75%) Oakland-SF 30 53 41 Antioch-SF 75 118 96 Antioch-Oakland 47 67 57 SJ-SF 64 100 87 Oakland-SJ 56 77 66 Oakland-Palo Alto 54 67 61 Part of Route Features All-Lane Tolling (25-75%) Livermore-SJ 48 75 74 Vallejo-SF 57 103 87 Limited or No Tolling on Route (<25%) Fairfield-Dublin 48 62 65 Santa Rosa-SF 69 136 138 Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050. PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINT SFMTA Bus 20%40%29% AC Transit Local 0%22%20% AC Transit Transbay 48%64%50% GGT Express 30%87%85% BART 19%62%44% Caltrain 8%32%50% WETA 23%59%43% SFMTA LRT 32%37%25% VTA LRT 0%82%83% In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050. SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT 30%30% WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE? Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas. SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINT High-Resource and Transit-Rich Areas 28%23% High-Resource (only) Areas 18%22% Transit-Rich (only) Areas 40%36% WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE? At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATION High Displacement Risk Tracts (total 850 neighborhoods)31%44% Communities of Concern (total 339 neighborhoods)42%56% Transit-Rich Areas (total 114 areas)13%46% High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% 3 | What are the Key Equity and Performance Outcomes of the Draft Blueprint? How does the Draft Blueprint advance or impede achievement of the Plan Vision? This section is organized by the five Plan Bay Area 2050 Guiding Principles with two key questions presented to frame the exploration. Each question is accompanied by one or more metrics, highlighting impacts on disadvantaged populations where feasible and indicating whether the 2050 Blueprint outcomes are equitable and favorable. Explanatory text sheds light on how Draft Blueprint strategies and assumptions contribute to performance outcomes. On the left, outcomes that move in the right direction are represented by upward arrows, while outcomes that move in the wrong direction or fail to meet state-mandated targets are represented with downward arrows. WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION? In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable. H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINT Low-Income Households (LIHH)109%86%83% All Households 57%48%48% Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINT Average Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60 All Households $3.16 $3.41 $2.96 Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11 All Households $1.26 $1.45 $1.53 Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10 All Households $0.08 $0.12 $0.21 WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING? 28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High- Resource Areas due to strategic investments in these locations. SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28% High-Resource Areas 37% The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes. SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100% WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY? The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend. (Metric under development for Final Blueprint: Accessibility to Community Places) PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINT By Car within30 Minutes CoC Residents 19.2%13.6%14.4% All Residents 17.8%12.2%12.6% By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2% All Residents 3.4%4.3%4.7% By Bike within20 Minutes CoC Residents 2.9%3.5%3.5% All Residents 2.3%2.8%2.8% By Foot within20 Minutes CoC Residents 0.3%0.4%0.4% All Residents 0.2%0.2%0.2% SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINT More households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46% All Households 32%43% Jobs Manufacturing/Warehouse/Utilities 45%43% All Jobs 52%52% WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON? Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times. PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINT Most of Route Features All-Lane Tolling (>75%) Oakland-SF 30 53 41 Antioch-SF 75 118 96 Antioch-Oakland 47 67 57 SJ-SF 64 100 87 Oakland-SJ 56 77 66 Oakland-Palo Alto 54 67 61 Part of Route Features All-Lane Tolling (25-75%) Livermore-SJ 48 75 74 Vallejo-SF 57 103 87 Limited or No Tolling on Route (<25%) Fairfield-Dublin 48 62 65 Santa Rosa-SF 69 136 138 Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050. PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINT SFMTA Bus 20%40%29% AC Transit Local 0%22%20% AC Transit Transbay 48%64%50% GGT Express 30%87%85% BART 19%62%44% Caltrain 8%32%50% WETA 23%59%43% SFMTA LRT 32%37%25% VTA LRT 0%82%83% In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050. SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT 30%30% WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE? Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas. SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINT High-Resource and Transit-Rich Areas 28%23% High-Resource (only) Areas 18%22% Transit-Rich (only) Areas 40%36% WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE? At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATION High Displacement Risk Tracts (total 850 neighborhoods)31%44% Communities of Concern (total 339 neighborhoods)42%56% Transit-Rich Areas (total 114 areas)13%46% High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% Attachment C Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION?In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable.H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINTLow-Income Households (LIHH)109%86%83%All Households 57%48%48%Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINTAverage Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60All Households $3.16 $3.41 $2.96Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11All Households $1.26 $1.45 $1.53Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10All Households $0.08 $0.12 $0.21WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING?28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High-Resource Areas due to strategic investments in these locations.SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28%High-Resource Areas 37%The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes.SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100% WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY? The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend. (Metric under development for Final Blueprint: Accessibility to Community Places) PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINT By Car within30 Minutes CoC Residents 19.2%13.6%14.4% All Residents 17.8%12.2%12.6% By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2% All Residents 3.4%4.3%4.7% By Bike within20 Minutes CoC Residents 2.9%3.5%3.5% All Residents 2.3%2.8%2.8% By Foot within20 Minutes CoC Residents 0.3%0.4%0.4% All Residents 0.2%0.2%0.2% SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINT More households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46% All Households 32%43% Jobs Manufacturing/Warehouse/Utilities 45%43% All Jobs 52%52% WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON? Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times. PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINT Most of Route Features All-Lane Tolling (>75%) Oakland-SF 30 53 41 Antioch-SF 75 118 96 Antioch-Oakland 47 67 57 SJ-SF 64 100 87 Oakland-SJ 56 77 66 Oakland-Palo Alto 54 67 61 Part of Route Features All-Lane Tolling (25-75%) Livermore-SJ 48 75 74 Vallejo-SF 57 103 87 Limited or No Tolling on Route (<25%) Fairfield-Dublin 48 62 65 Santa Rosa-SF 69 136 138 Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050. PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINT SFMTA Bus 20%40%29% AC Transit Local 0%22%20% AC Transit Transbay 48%64%50% GGT Express 30%87%85% BART 19%62%44% Caltrain 8%32%50% WETA 23%59%43% SFMTA LRT 32%37%25% VTA LRT 0%82%83% In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050. SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT 30%30% WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE? Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas. SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINT High-Resource and Transit-Rich Areas 28%23% High-Resource (only) Areas 18%22% Transit-Rich (only) Areas 40%36% WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE? At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATION High Displacement Risk Tracts (total 850 neighborhoods)31%44% Communities of Concern (total 339 neighborhoods)42%56% Transit-Rich Areas (total 114 areas)13%46% High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION?In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable.H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINTLow-Income Households (LIHH)109%86%83%All Households 57%48%48%Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINTAverage Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60All Households $3.16 $3.41 $2.96Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11All Households $1.26 $1.45 $1.53Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10All Households $0.08 $0.12 $0.21WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING?28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High-Resource Areas due to strategic investments in these locations.SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28%High-Resource Areas 37%The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes.SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100%WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY?The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend.(Metric under development for Final Blueprint: Accessibility to Community Places)PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINTBy Car within30 Minutes CoC Residents 19.2%13.6%14.4%All Residents 17.8%12.2%12.6%By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2%All Residents 3.4%4.3%4.7%By Bike within20 Minutes CoC Residents 2.9%3.5%3.5%All Residents 2.3%2.8%2.8%By Foot within20 Minutes CoC Residents 0.3%0.4%0.4%All Residents 0.2%0.2%0.2%SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINTMore households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46%All Households 32%43% Jobs Manufacturing/Warehouse/Utilities 45%43% All Jobs 52%52% WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON? Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times. PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINT Most of Route Features All-Lane Tolling (>75%) Oakland-SF 30 53 41 Antioch-SF 75 118 96 Antioch-Oakland 47 67 57 SJ-SF 64 100 87 Oakland-SJ 56 77 66 Oakland-Palo Alto 54 67 61 Part of Route Features All-Lane Tolling (25-75%) Livermore-SJ 48 75 74 Vallejo-SF 57 103 87 Limited or No Tolling on Route (<25%) Fairfield-Dublin 48 62 65 Santa Rosa-SF 69 136 138 Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050. PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINT SFMTA Bus 20%40%29% AC Transit Local 0%22%20% AC Transit Transbay 48%64%50% GGT Express 30%87%85% BART 19%62%44% Caltrain 8%32%50% WETA 23%59%43% SFMTA LRT 32%37%25% VTA LRT 0%82%83% In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050. SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT 30%30% WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE? Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas. SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINT High-Resource and Transit-Rich Areas 28%23% High-Resource (only) Areas 18%22% Transit-Rich (only) Areas 40%36% WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE? At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATION High Displacement Risk Tracts (total 850 neighborhoods)31%44% Communities of Concern (total 339 neighborhoods)42%56% Transit-Rich Areas (total 114 areas)13%46% High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% 3 | What are the Key Equity and Performance Outcomes of the Draft Blueprint?WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION?In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable.H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINTLow-Income Households (LIHH)109%86%83%All Households 57%48%48%Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINTAverage Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60All Households $3.16 $3.41 $2.96Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11All Households $1.26 $1.45 $1.53Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10All Households $0.08 $0.12 $0.21WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING?28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High-Resource Areas due to strategic investments in these locations.SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28%High-Resource Areas 37%The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes.SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100%WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY?The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend.(Metric under development for Final Blueprint: Accessibility to Community Places)PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINTBy Car within30 Minutes CoC Residents 19.2%13.6%14.4%All Residents 17.8%12.2%12.6%By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2%All Residents 3.4%4.3%4.7%By Bike within20 Minutes CoC Residents 2.9%3.5%3.5%All Residents 2.3%2.8%2.8%By Foot within20 Minutes CoC Residents 0.3%0.4%0.4%All Residents 0.2%0.2%0.2%SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINTMore households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46%All Households 32%43% Jobs Manufacturing/Warehouse/Utilities 45%43% All Jobs 52%52% WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON? Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times. PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINT Most of Route Features All-Lane Tolling (>75%) Oakland-SF 30 53 41 Antioch-SF 75 118 96 Antioch-Oakland 47 67 57 SJ-SF 64 100 87 Oakland-SJ 56 77 66 Oakland-Palo Alto 54 67 61 Part of Route Features All-Lane Tolling (25-75%) Livermore-SJ 48 75 74 Vallejo-SF 57 103 87 Limited or No Tolling on Route (<25%) Fairfield-Dublin 48 62 65 Santa Rosa-SF 69 136 138 Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050. PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINT SFMTA Bus 20%40%29% AC Transit Local 0%22%20% AC Transit Transbay 48%64%50% GGT Express 30%87%85% BART 19%62%44% Caltrain 8%32%50% WETA 23%59%43% SFMTA LRT 32%37%25% VTA LRT 0%82%83% In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050. SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT 30%30% WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE? Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas. SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINT High-Resource and Transit-Rich Areas 28%23% High-Resource (only) Areas 18%22% Transit-Rich (only) Areas 40%36% WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE? At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATION High Displacement Risk Tracts (total 850 neighborhoods)31%44% Communities of Concern (total 339 neighborhoods)42%56% Transit-Rich Areas (total 114 areas)13%46% High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern. Attachment C Agenda Item 4a Bay Area Metro Center375 Beale SteetSanFrancisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION?In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable.H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINTLow-Income Households (LIHH)109%86%83%All Households 57%48%48%Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINTAverage Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60All Households $3.16 $3.41 $2.96Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11All Households $1.26 $1.45 $1.53Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10All Households $0.08 $0.12 $0.21WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING?28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High-Resource Areas due to strategic investments in these locations.SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28%High-Resource Areas 37%The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes.SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100%WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY?The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend.(Metric under development for Final Blueprint: Accessibility to Community Places)PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINTBy Car within30 Minutes CoC Residents 19.2%13.6%14.4%All Residents 17.8%12.2%12.6%By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2%All Residents 3.4%4.3%4.7%By Bike within20 Minutes CoC Residents 2.9%3.5%3.5%All Residents 2.3%2.8%2.8%By Foot within20 Minutes CoC Residents 0.3%0.4%0.4%All Residents 0.2%0.2%0.2%SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINTMore households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46%All Households 32%43%Jobs Manufacturing/Warehouse/Utilities 45%43%All Jobs 52%52%WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON?Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times.PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINTMost of Route Features All-Lane Tolling (>75%)Oakland-SF 30 53 41Antioch-SF 75 118 96Antioch-Oakland 47 67 57SJ-SF 64 100 87Oakland-SJ 56 77 66Oakland-Palo Alto 54 67 61Part of Route Features All-Lane Tolling (25-75%)Livermore-SJ 48 75 74Vallejo-SF 57 103 87Limited or No Tolling on Route (<25%)Fairfield-Dublin 48 62 65Santa Rosa-SF 69 136 138Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050.PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINTSFMTA Bus 20%40%29%AC Transit Local 0%22%20%AC Transit Transbay 48%64%50%GGT Express 30%87%85%BART 19%62%44%Caltrain 8%32%50%WETA 23%59%43%SFMTA LRT 32%37%25%VTA LRT 0%82%83%In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050.SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT30%30%WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE?Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas.SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINTHigh-Resource and Transit-Rich Areas 28%23%High-Resource (only) Areas 18%22%Transit-Rich (only) Areas 40%36%WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE?At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern.SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATIONHigh Displacement Risk Tracts (total 850 neighborhoods)31%44%Communities of Concern (total 339 neighborhoods)42%56%Transit-Rich Areas (total 114 areas)13%46%High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% 3 | What are the Key Equity and Performance Outcomes of the Draft Blueprint?WILL BAY AREA RESIDENTS SPEND LESS ON HOUSING AND TRANSPORTATION?In 2015, low-income households have an extreme housing and transportation (H+T) cost burden, with costs exceeding average incomes when accounting for circumstances such as zero-income, financial assistance or unhoused status. With all Draft Blueprint housing strategies in place in 2050 Trend, H+T costs as a percentage of income decrease for all households. The addition of Draft Blueprint transportation strategies, including means-based tolls and fares, further reduces H+T costs for low-income households, though their cost burden remains deeply unaff ordable.H+T COST AS A PERCENT OF INCOME 2015 2050 TREND 2050 BLUEPRINTLow-Income Households (LIHH)109%86%83%All Households 57%48%48%Average transit fares per trip, while up in 2050 Trend due to recent fare increases since 2015, decrease in 2050 Blueprint with fare reform policies. The decrease is substantial for low-income households with means-based fares. Average tolls per auto trip increase due to the freeway per-mile tolling strategy, with reduced impact on low-income households due to means-based toll discounts. TRANSPORT EXPENSES PER TRIP 2015 2050 TREND 2050 BLUEPRINTAverage Fareper Transit Trip Low-Income Households $2.78 $3.13 $1.60All Households $3.16 $3.41 $2.96Average “Out-of-Pocket” Cost per Auto Trip Low-Income Households $1.02 $1.10 $1.11All Households $1.26 $1.45 $1.53Average Tollper Auto Trip Low-Income Households $0.05 $0.08 $0.10All Households $0.08 $0.12 $0.21WILL THE BAY AREA PRODUCE AND PRESERVE MORE AFFORDABLE HOUSING?28 percent of all new homes built between 2015 and 2050 are permanently aff ordable (deed-restricted) for low-income households, with an even greater share of these units in High-Resource Areas due to strategic investments in these locations.SHARE OF NEW HOUSING PRODUCTION (2015-50) THAT IS DEED-RESTRICTED AFFORDABLE Region-Wide 28%High-Resource Areas 37%The Draft Blueprint’s affordable housing preservation strategy ensures that all existing deed-restricted affordable units at risk of conversion to market-rate units are converted to permanently affordable (deed-restricted) homes.SHARE OF AT-RISK AFFORDABLE HOUSING PRESERVED Region-Wide 100%WILL BAY AREA RESIDENTS BE ABLE TO ACCESS THEIR DESTINATIONS MORE EASILY?The number of jobs accessible within a 30-minute drive is forecasted to decrease in 2050 Trend due to population growth and subsequent road congestion, but it increases marginally with the Draft Blueprint. Meanwhile, the number of jobs accessible within a 45-minute transit trip is significantly lower than auto accessibility in 2015. Focused housing growth near transit routes increases transit accessibility in 2050 Trend, and performance improves further with investments in transit service in the Draft Blueprint. Biking and walking access to jobs also increases with land use strategies in 2050 Trend.(Metric under development for Final Blueprint: Accessibility to Community Places)PERCENT OF ALL BAY AREA JOBS THAT ARE ACCESSIBLE BY 2015 2050 TREND 2050 BLUEPRINTBy Car within30 Minutes CoC Residents 19.2%13.6%14.4%All Residents 17.8%12.2%12.6%By Transit within 45 Minutes CoC Residents 5.2%6.6%7.2%All Residents 3.4%4.3%4.7%By Bike within20 Minutes CoC Residents 2.9%3.5%3.5%All Residents 2.3%2.8%2.8%By Foot within20 Minutes CoC Residents 0.3%0.4%0.4%All Residents 0.2%0.2%0.2%SHARE OF HOUSEHOLDS AND JOBS WITHIN 1/2 MILE OF FREQUENT TRANSIT 2015 2050 BLUEPRINTMore households will live close to high-frequency transit, including rail, ferry and frequent bus stops, in 2050 under the Draft Blueprint. Growth geographies focus more growth in Transit-Rich Areas, supported by more transit service in these communities. Due to the more dispersed nature of job growth, the share of jobs near high-frequency transit remains relatively constant. Households Low-Income Households 40%46%All Households 32%43%Jobs Manufacturing/Warehouse/Utilities 45%43%All Jobs 52%52%WILL BAY AREA RESIDENTS HAVE A TRANSPORTATION SYSTEM THEY CAN RELY ON?Travel times on freeways are forecasted to increase significantly between 2015 and 2050 Trend, again due to a growing population. Under 2050 Draft Blueprint conditions, per-mile freeway tolling on key corridors helps to alleviate this eff ect, even as speed limits reduce free-flow travel times.PEAK-HOUR TRAVEL TIME (MINUTES)2015 2050 TREND 2050 BLUEPRINTMost of Route Features All-Lane Tolling (>75%)Oakland-SF 30 53 41Antioch-SF 75 118 96Antioch-Oakland 47 67 57SJ-SF 64 100 87Oakland-SJ 56 77 66Oakland-Palo Alto 54 67 61Part of Route Features All-Lane Tolling (25-75%)Livermore-SJ 48 75 74Vallejo-SF 57 103 87Limited or No Tolling on Route (<25%)Fairfield-Dublin 48 62 65Santa Rosa-SF 69 136 138Overcrowding on transit vehicles, which risks denial of boarding, is anticipated to rise significantly under 2050 Trend conditions. Crowding decreases in the 2050 Draft Blueprint for agencies with planned investments, such as Muni and AC Transit, as well as in the transbay corridor thanks to the New Transbay Rail Crossing. Agencies not listed are not forecasted to have overcrowding challenges in 2050.PERCENT OF PERSON HOURS IN TRANSIT SPENT IN CROWDED CONDITIONS 2015 2050 TREND 2050 BLUEPRINTSFMTA Bus 20%40%29%AC Transit Local 0%22%20%AC Transit Transbay 48%64%50%GGT Express 30%87%85%BART 19%62%44%Caltrain 8%32%50%WETA 23%59%43%SFMTA LRT 32%37%25%VTA LRT 0%82%83%In 2015, 30 percent of all transit vehicles had exceeded their federally recommended lifespans. As the Draft Blueprint only includes enough maintenance funding to retain existing conditions, this metric remains mostly unchanged through 2050.SHARE OF TRANSIT REVENUE VEHICLE ASSETS PASTTHEIR USEFUL LIFE BENCHMARK 2015 2050 BLUEPRINT30%30%WILL BAY AREA COMMUNITIES BE MORE INCLUSIVE?Focused production of deed-restricted aff ordable housing in High-Resource Areas increases access to areas of highest opportunity for low-income households, helping reverse historically exclusionary policies in many of these communities. In Transit-Rich Areas, the total number of low-income households continues to rise, but the share declines over time. This indicates that aff ordable housing growth may not be keeping pace with overall development in Transit-Rich Areas.SHARE OF HOUSEHOLDS THAT ARE LOW-INCOME 2015 2050 BLUEPRINTHigh-Resource and Transit-Rich Areas 28%23%High-Resource (only) Areas 18%22%Transit-Rich (only) Areas 40%36%WILL BAY AREA RESIDENTS BE ABLE TO STAY IN PLACE?At the neighborhood level, the risk of displacement persists in many low-income communities and communities of color. The Urban Displacement Project has identified 850 census tracts with ongoing or risk of displacement, gentrification or exclusion. In the Blueprint, 31% of these tracts experience displacement between 2015 and 2050 – defined here as a net loss in number of Low-Income Households. Further, nearly half of them experience gentrification – defined here as when the share of low-income households in the neighborhood drops by over 10 percent between 2015 and 2050. Even more significant impacts are forecasted for Communities of Concern.SHARE OF NEIGHBORHOODS THAT EXPERIENCE DISPLACEMENT AND GENTRIFICATION BETWEEN 2015 AND 2050 DISPLACEMENT GENTRIFICATIONHigh Displacement Risk Tracts (total 850 neighborhoods)31%44%Communities of Concern (total 339 neighborhoods)42%56%Transit-Rich Areas (total 114 areas)13%46%High-Resource Neighborhoods (total 638 neighborhoods)18%26% WILL BAY AREA RESIDENTS BE HEALTHIER AND SAFER? With Draft Blueprint strategies, 98 percent of all Bay Area households that would be aff ected by two feet of sea level rise are protected. All common seismically deficient housing types and homes built in high wildfire risk zones would be retrofitted to reduce the likelihood of damage in future earthquakes and wildfires. PERCENT OF HOUSEHOLDS IN RISK-PRONE AREAS OR RISK-PRONE BUILDINGS, THAT ARE PROTECTED OR RETROFIT Sea Level Rise(2ft) Communities of Concern 100% All Households 98% Earthquake Communities of Concern 100% All Households 100% Wildfire High /Medium Risk Communities of Concern 100% All Households 100% The rate of fatalities and injuries decreases in the Draft Blueprint with reduced speed limits and enhanced street design under the Vision Zero strategy, but remains far from zero incidents. ANNUAL INCIDENTS,PER 100 MILLION VMT 2015 2050 TREND 2050 BLUEPRINT Fatalities 0.98 0.99 0.91 Injuries 4.23 4.35 4.20 Total fine particulate matter emissions (PM2.5) are forecasted to increase under 2050 Trend conditions as population and miles driven continue to rise. The Draft Blueprint strategies help bring this metric down below 2015 levels. DAILY PM2.5 EMISSIONS (TONS)5.5 5.7 5.2 WILL THE ENVIRONMENT OF THE BAY AREA BE HEALTHIER AND SAFER? Draft Blueprint strategies result in a drop in CO2 emission levels per capita in 2035 (9% below 2005 levels), but are insuff icient to curb them to state-mandated levels (19% below 2005 levels). Further, CO2 emission levels are forecasted to increase between 2035 and 2050 (in both Trend and Blueprint), primarily due to assumed adoption of driverless vehicles that can potentially generate “zero occupant” mileage. CHANGE IN DAILY CO2 EMISSIONS PER CAPITA RELATIVE TO 2005 2015 2035TREND 2035BLUEPRINT 2050TREND 2050BLUEPRINT Cars and Light-Duty Trucks (SB 375)0%8%-9%14%-3% All Vehicles(Including Fuel Eff iciency Gains)-7%-36%-42%-38%-43% With an assumed growth in telecommuting by 2050, the mode share of single occupancy auto travel is forecasted to drop in 2050 Trend conditions. With the Draft Blueprint strategies in play, this share drops slightly further, with increases in transit, walking and bicycling mode shares. COMMUTE MODE SHARE 2015 2050 TREND 2050 BLUEPRINT Auto: Single Occupancy 54%42%40% Auto: Other 21%19%18% Transit 14%19%20% Active Modes (Bike/Walk)5%6%8% Telecommute 6%14%14% WILL JOBS AND HOUSING IN THE BAY AREA BE MORE EVENLY DISTRIBUTED? County-level jobs-to-housing ratios decrease in most counties, reflecting a higher ratio of housing to job production. Further, the ratios in Alameda, San Francisco and Santa Clara counties approach the region-wide ratio in 2050, indicating an improved jobs-housing balance. However, other counties trend further away from the region-wide ratio. These trends indicate that housing strategies in the Draft Blueprint may bring housing to job-rich areas such as Silicon Valley, but strategies to move jobs to housing-rich areas are not suff icient. (Metric under development for Final Blueprint: Jobs-Housing Fit for low-wage jobs) JOBS-HOUSING RATIO 2015 2050 BLUEPRINT 2015 2050 BLUEPRINT Region-Wide 1.50 1.34 San Francisco 2.55 2.21 Alameda 1.48 1.33 San Mateo 1.29 1.21 Contra Costa 0.98 0.98 Santa Clara 1.69 1.41 Marin 1.09 0.75 Solano 0.87 0.89 Napa 1.24 1.46 Sonoma 1.05 0.89 Mean commute distances rise from 2015 to 2050 Trend with Draft Blueprint land use strategies, due to the clustering of jobs in existing centers far from housing-rich communities. Transportation strategies on their own aff ect this metric only marginally in 2050 Blueprint. MEAN COMMUTE DISTANCE (MILES) 2015 2050 TREND 2050 BLUEPRINT Low-Income Workers 9.5 12.0 11.9 All Workers 12.0 13.1 12.9 WILL BAY AREA BUSINESSES THRIVE? The region’s economic recovery is expected to be robust through 2050, even when accounting for the inclusion of new regional tax measures to fund transportation and aff ordable housing, among other areas. GROWTH IN PER CAPITA GROSS REGIONAL PRODUCT (FROM 2015 TO 2050)65% A key pillar in the region’s middle-wage workforce, manufacturing and warehouse jobs are anticipated to grow at a higher rate than other industries, with some of that growth occurring in newly-designated Priority Production Areas. GROWTH IN NUMBER OF JOBS (FROM 2015 TO 2050) Region-Wide All Jobs 35% Manufacturing/Warehouse/Utilities Jobs 48% Priority Production Areas All Jobs 42% Manufacturing/Warehouse/Utilities Jobs 48% Attachment C Agenda Item 4a @MTCBATA MTCBATAplanbayarea.org info@planbayarea.org @mtcbata #BayArea2050 How Will COVID-19 Affect the Final Blueprint? COVID-19 has upended everyday life throughout the world and intensified existing challenges, and we all feel uncertain about what the future holds. While Plan Bay Area 2050 is a 30-year vision for the Bay Area, many of the strategies approved for analysis by the MTC Commission and ABAG Executive Board in February have only become more timely. The Final Blueprint will continue to focus on strategies such as: BUILD A COMPLETE STREETS NETWORK: Enhance streets to promote walking, biking, and other micromobility through improvements to the pedestrian environment and thousands of miles of bike lanes or multi-use paths with investments targeted in Communities of Concern and near transit. STRENGTHEN RENTER PROTECTIONS BEYOND STATE LEGISLATION: Building upon recent tenant protection laws, limit annual rent increases to the rate of inflation, while exempting units less than 10 years old. EXPAND CHILDCARE SUPPORT FOR LOW-INCOME FAMILIES: Subsidize childcare for low-income households with children under 5, enabling more parents with young children to remain in (or to enter) the workforce. PROTECT HIGH-VALUE CONSERVATION LANDS: Provide strategic matching funds to help conserve high-priority natural and agricultural lands, expand regional trails, and restore marshlands. Challenges • Affordable housing production is insufficient to address the existing need for affordable units in the Bay Area. • Traffic congestion and transit crowding increase significantly with population growth and will not be sufficiently addressed with existing strategies. • Low-income residents continue to face a high risk of displacement, particularly in Communities of Concern. • Per capita greenhouse gas emissions decline, but still fail to meet state-mandated reduction targets. • More ambitious strategies are needed to shift jobs closer to the region’s workforce. Highlights • Housing and transportation costs are significantly reduced, especially for low-income residents. • New revenues enable a significant uptick in production of deed- restricted affordable homes. • Most new homes are focused in walkable communities with frequent transit service. • Strategies to reduce vehicle speeds and build protected bicycle/ pedestrian infrastructure help to save lives. • Seismic retrofits and sea level rise infrastructure protect thousands of homes from damage. • Despite significant tax increases to pay for new strategies, Bay Area businesses continue to thrive. 4 | What are the Key Takeaways from the Draft Blueprint? What’s Next for the Final Blueprint? JULY/EARLY AUGUST 2020 • Public Engagement: Online and Remote Offline Opportunities MID-AUGUST 2020 • Refine Strategies • Close of Blueprint Comment Period SEPTEMBER 2020 • Seek Approval of Final Blueprint for Analysis DECEMBER 2020 • Release Final Blueprint and Seek Action on Preferred EIR Alternative INPUTS Baseline Data (Zoning, Pipeline, Growth Boundaries, etc.) INPUTS Strategies and Growth Geographies (February 2020 Approval for Analysis) ANALYSIS & MODELING Economic, Transportation and Land Use Analysis and Modeling (Spring 2020) OUTCOMES Performance Metrics and Growth Pattern (July 2020 Release) How Can You Get Involved in July/Early August? (From Home!) Virtual Public Workshops Online Survey and Official Comment Period (ends August 10) Telephone Townhalls 5 | How Did We Analyze the Draft Blueprint? Attachment C Agenda Item 4a Bay Area Metro Center375 Beale Steet San Francisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov This technical appendix summarizes the growth pattern of households and jobs at the county and sub-county levels in the Plan Bay Area 2050 Draft Blueprint. For more information on outcomes of the Draft Blueprint, refer to the Outcomes PDF document. PROJECTED HOUSEHOLD AND JOB GROWTH, BY COUNTY HOUSEHOLDS JOBS COUNTY 2015 2050 GROWTH PERCENT GROWTH SHARE OF REGIONAL GROWTH 2015 2050 GROWTH PERCENT GROWTH SHARE OF REGIONAL GROWTH San Francisco 362,000 501,000 139,000 +38%10%925,000 1,107,000 182,000 +20%13% San Mateo 267,000 404,000 137,000 +51%10%349,000 494,000 145,000 +41%10% Santa Clara 618,000 1,177,000 559,000 +91%41%1,036,000 1,647,000 612,000 +59%44% Alameda 553,000 809,000 256,000 +46%19%815,000 1,077,000 262,000 +32%19% Contra Costa 383,000 490,000 108,000 +28%8%374,000 480,000 107,000 +29%8% Solano 144,000 188,000 45,000 +31%3%124,000 168,000 43,000 +35%3% Napa 51,000 60,000 9,000 +18%1%63,000 88,000 24,000 +38%2% Sonoma 190,000 271,000 81,000 +42%6%199,000 240,000 41,000 +21%3% Marin 109,000 142,000 33,000 +30%2%120,000 107,000 –13,000 –11%–1% REGION 2,677,000 4,043,000 1,367,000 +51%100%4,005,000 5,408,000 1,403,000 +35%100% HELP US DRAFT THE BLUEPRINT.TECHNICAL APPENDIX: DRAFT BLUEPRINT GROWTH PATTERN DRAFTING THE BLUEPRINT Numbers may not always sum to 100% due to rounding. Bay Area Metro Center375 Beale Steet San Francisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov Bay Area Metro Center375 Beale Steet San Francisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov PROJECTED HOUSEHOLD AND JOB GROWTH, BY SUPERDISTRICT HOUSEHOLDS JOBS COUNTY SUPER-DISTRICT SUPERDISTRICT NAME 2015 2050 GROWTH PERCENT GROWTH SHARE OF REGIONAL GROWTH 2015 2050 GROWTH PERCENT GROWTH SHARE OF REGIONAL GROWTH San Francisco 1 Northeast San Francisco County 83,000 126,000 43,000 +52%3%504,000 578,000 74,000 +15%5% 2 Northwest San Francisco County 108,000 125,000 17,000 +16%1%89,000 103,000 14,000 +15%1% 3 Southeast San Francisco County 120,000 189,000 69,000 +57%5%300,000 389,000 89,000 +30%6% 4 Southwest San Francisco County 51,000 62,000 10,000 +20%1%32,000 38,000 6,000 +18%0% San Mateo 5 North San Mateo County 98,000 175,000 76,000 +78%6%119,000 206,000 88,000 +74%6% 6 Central San Mateo County 88,000 117,000 28,000 +32%2%95,000 108,000 13,000 +14%1% 7 South San Mateo County 80,000 113,000 32,000 +40%2%135,000 180,000 44,000 +32%3% Santa Clara 8 Northwest Santa Clara County 74,000 135,000 61,000 +83%4%161,000 168,000 8,000 +5%1% 9 West Santa Clara County 104,000 263,000 159,000 +152%12%367,000 790,000 423,000 +115%30% 10 North Santa Clara County 121,000 202,000 81,000 +67%6%133,000 164,000 30,000 +23%2% 11 Central Santa Clara County 104,000 221,000 117,000 +113%9%166,000 271,000 106,000 +64%8% 12 East Santa Clara County 108,000 201,000 93,000 +87%7%109,000 125,000 16,000 +15%1% 13 Southwest Santa Clara County 73,000 101,000 28,000 +38%2%51,000 73,000 22,000 +42%2% 14 South Santa Clara County 34,000 54,000 20,000 +58%1%48,000 56,000 8,000 +17%1% Alameda 15 East Alameda County 72,000 113,000 42,000 +58%3%124,000 154,000 31,000 +25%2% 16 South Alameda County 106,000 160,000 55,000 +52%4%138,000 229,000 91,000 +66%7% 17 Central Alameda County 122,000 144,000 22,000 +18%2%148,000 222,000 74,000 +50%5% 18 North Alameda County 180,000 290,000 110,000 +61%8%264,000 316,000 52,000 +20%4% 19 Northwest Alameda County 74,000 101,000 28,000 +37%2%142,000 156,000 14,000 +10%1% Contra Costa 20 West Contra Costa County 90,000 120,000 31,000 +34%2%76,000 118,000 43,000 +56%3% 21 North Contra Costa County 86,000 102,000 16,000 +19%1%110,000 151,000 40,000 +37%3% 22 Central Contra Costa County 60,000 81,000 21,000 +35%2%74,000 78,000 3,000 +5%0% 23 South Contra Costa County 54,000 66,000 12,000 +22%1%61,000 62,000 1,000 +2%0% 24 East Contra Costa County 93,000 121,000 28,000 +30%2%53,000 72,000 19,000 +37%1% Solano 25 North Solano County 53,000 61,000 8,000 +15%1%42,000 54,000 12,000 +29%1% 26 South Solano County 91,000 128,000 37,000 +41%3%82,000 114,000 31,000 +38%2% Napa 27 South Napa County 35,000 42,000 7,000 +21%1%44,000 63,000 19,000 +43%1% 28 North Napa County 16,000 18,000 2,000 +12%0%19,000 25,000 5,000 +28%0% Sonoma 29 South Sonoma County 65,000 85,000 20,000 +31%1%65,000 79,000 13,000 +20%1% 30 Central Sonoma County 89,000 142,000 53,000 +59%4%107,000 122,000 15,000 +14%1% 31 North Sonoma County 36,000 44,000 8,000 +22%1%27,000 40,000 13,000 +48%1% Marin 32 North Marin County 23,000 32,000 9,000 +38%1%26,000 31,000 5,000 +19%0% 33 Central Marin County 44,000 61,000 16,000 +37%1%56,000 41,000 –15,000 –26%–1% 34 South Marin County 41,000 49,000 7,000 +18%1%38,000 35,000 –3,000 –8%–0% REGION 2,677,000 4,043,000 1,367,000 +51%100%4,005,000 5,408,000 1,403,000 +35%100% HELP US DRAFT THE BLUEPRINT.TECHNICAL APPENDIX: DRAFT BLUEPRINT GROWTH PATTERNDRAFTING THE BLUEPRINT Numbers may not always sum to 100% due to rounding. Bay Area Metro Center375 Beale Steet San Francisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov Bay Area Metro Center375 Beale Steet San Francisco, CA 94105 415.778.6700info@bayareametro.govabag.ca.gov | mtc.ca.gov HELP US DRAFT THE BLUEPRINT.TECHNICAL APPENDIX: DRAFT BLUEPRINT GROWTH PATTERNDRAFTING THE BLUEPRINT SUPER- DISTRICT COUNTY SUPERDISTRICT NAME PRIMARY JURISDICTIONS INCLUDED IN SUPERDISTRICT 1 San Francisco Northeast San Francisco County San Francisco (partial) 2 San Francisco Northwest San Francisco County San Francisco (partial) 3 San Francisco Southeast San Francisco County San Francisco (partial) 4 San Francisco Southwest San Francisco County San Francisco (partial) 5 San Mateo North San Mateo County Brisbane, Colma, Daly City, Pacific, South San Francisco, Millbrae, San Bruno, Burlingame (partial) 6 San Mateo Central San Mateo County Half Moon Bay, Hillsborough, San Mateo, Foster City, Belmont, Burlingame (partial) 7 San Mateo South San Mateo County Atherton, Menlo Park, Redwood City, Woodside, East Palo Alto, Portola Valley, San Carlos 8 Santa Clara Northwest Santa Clara County Los Altos Hills, Los Altos, Palo Alto (partial), Mountain View (partial) 9 Santa Clara West Santa Clara County Sunnyvale, Santa Clara (partial), Mountain View (partial), Milpitas (partial), San Jose (partial), Palo Alto (partial) 10 Santa Clara North Santa Clara County Los Gatos, Monte Sereno, Saratoga, Cupertino, Campbell (partial), Santa Clara (partial) 11 Santa Clara Central Santa Clara County Campbell (partial), San Jose (partial) 12 Santa Clara East Santa Clara County Milpitas (partial), San Jose (partial) 13 Santa Clara Southwest Santa Clara County San Jose (partial) 14 Santa Clara South Santa Clara County Gilroy, Morgan Hill, San Jose (partial) 15 Alameda East Alameda County Dublin, Livermore, Pleasanton 16 Alameda South Alameda County Newark, Fremont, Union City 17 Alameda Central Alameda County San Leandro, Hayward 18 Alameda North Alameda County Alameda, Piedmont, Oakland 19 Alameda Northwest Alameda County Albany, Berkeley, Emeryville 20 Contra Costa West Contra Costa County El Cerrito, Hercules, Pinole, Richmond, San Pablo 21 Contra Costa North Contra Costa County Clayton, Pleasant Hill, Concord, Martinez, Lafayette (partial), Pittsburg (partial) 22 Contra Costa Central Contra Costa County Moraga, Orinda, Walnut Creek, Lafayette (partial) 23 Contra Costa South Contra Costa County Danville, San Ramon, Walnut Creek 24 Contra Costa East Contra Costa County Antioch, Brentwood, Oakley, Pittsburg (partial) 25 Solano North Solano County Benicia, Vallejo 26 Solano South Solano County Dixon, Fairfield, Rio Vista, Suisun City, Vacaville 27 Napa South Napa County American Canyon, Napa 28 Napa North Napa County Calistoga, St. Helena, Yountville 29 Sonoma South Sonoma County Cotati, Petaluma, Sonoma, Rohnert Park 30 Sonoma Central Sonoma County Santa Rosa, Sebastopol 31 Sonoma North Sonoma County Cloverdale, Healdsburg, Windsor 32 Marin North Marin County Novato 33 Marin Central Marin County Fairfax, San Anselmo, San Rafael, Ross 34 Marin South Marin County Belvedere, Corte Madera, Mill Valley, Sausalito, Tiburon, Larkspur REGIONAL MAP – SUPERDISTRICTS City of Palo Alto (ID # 11514) City Council Staff Report Report Type: Action Items Meeting Date: 8/3/2020 City of Palo Alto Page 1 Council Priority: Transportation and Traffic Summary Title: Discuss Caltrain Proposed 1/8-Cent Sales Tax Measure Title: Discussion and Direction Regarding Potential Placement of a CalTrain 1/8-cent Sales Tax Measure on the November 3, 2020 Ballot From: City Manager Lead Department: Transportation Department Recommendation Staff recommends that the City Council sends a letter requesting that the Santa Clara County Board of Supervisors support placing a Caltrain 1/8-cent sales tax measure on the November 2020 ballot. Background Caltrain is Palo Alto’s primary regional transit service, with riders traveling between San Francisco and Gilroy. Caltrain service creates a hub connecting Palo Alto to regional rail and to both intercity and regional bus service, private shuttles, and the Stanford campus. Under normal operating circumstances, the Palo Alto Transit Center serves as the second-largest generator of weekday Caltrain trips, behind San Francisco’s 4th and King Street station. Palo Alto also has a station at the California Avenue downtown district, and a third station that serves Stanford during special events. Caltrain relies on receiving 70% of its operating funding from farebox revenues, with the remaining funding coming from parking fees, advertising, and member agency contributions. The agency, unlike other similar Bay Area transit agencies, is vulnerable due to a lack of a dedicated source of funding. Because of the impact of COVID-19, the current economic state, and social distancing implications on transit, Caltrain is currently forecasting a $71 million deficit over the next financial year. Without a resolution to this funding deficit, Caltrain believes that the system could be forced to shut down for years. Polling has shown that despite the economic situation, the measure is politically viable in 2020. In 2017, Senate Bill No. 797 authorized a consolidated three county election to permanently fund Caltrain operations following approval from the Caltrain Board, and the Supervisors of City of Palo Alto Page 2 Santa Clara County, San Francisco County, and San Mateo County along with the three County Transportation Agencies (VTA, SFMTA, SAMTRANS). If approved by all seven boards, voters in the three counties will have the opportunity to weigh in during the November election, with 2/3 of total votes across all three counties necessary for approval. If voters approve of the measure, it stands to generate approximately $108 million per year for Caltrain operating and capital needs. This measure would generate enough revenue to make the Caltrain 2040 service vision possible, which aims to provide higher frequency transit, thus producing higher ridership. Discussion and Timeline The item before the City Council is to provide time for the City Council to consider sending a letter to regional bodies that are taking up whether or not to place a ballot measure on the November 2020 ballot. In mid-July, while the full Council was on recess, the Mayor sent a letter urging regional partners to allow voters to decide by placing a measure on the November 2020 ballot. This letter was in response to the San Francisco Board of Supervisors July 14 action to not add the 1/8 cent sales tax measure to the ballot. This refusal meant that prompt action by other cities in the region to weigh in on this issue was necessary to share community concerns and ensure that voters have a choice on this matter. In order for a ballot measure to be on the November ballot, the San Francisco Board of Supervisors needed to take action by July 31. At the time there was a sense of urgency for Palo Alto to share concerns on this matter while the City Council was on summer recess. The letter was written in accordance with City Council and City policies. It also supports a foundational principle from the City of Palo Alto City Council’s legislative guidelines includes protecting, seeking, and increasing funding for programs, projects, and services. Other council advocacy guidelines include supporting local and regional public transportation and supporting the collaborative work of regional partners, trade associations, and Joint Powers Authorities. These guidelines were approved by the City Council in late 2019. In addition, the City Council unanimously established “improving mobility for all” as one of three City Council priorities in February 2020. These Council discussions were open to the public, informed through an online survey of the community that garnered over 500 recommended priorities, and set our Council-driven focus for 2020. The financial health and future of Caltrain is an important priority and one that ties directly to the City Council’s priority for 2020. Advancement of the ballot measure was unlikely at the time. The San Francisco Board of Supervisors subsequently agendized a resolution for one-eighth of one percent retail transaction and use tax for Caltrain or its successor agency to use as certain conditions are met to support immediate and long term operational and capital costs, at an election to be held on November 3, 2020. On July 28, 2020 the San Francisco Board of Supervisors approved this resolution by unanimous decision. This resolution as amended contains the following: • Revenues will be held in Special Escrow Account to be dispersed by the Joint Powers (Caltrain) Board, for eligible expenditures at any time with a 2/3 majority City of Palo Alto Page 3 • Up to the first $40 Million collected shall offset the member operating contributions and replace COVID related fare losses, if no/limited additional Federal emergency relief funds are made available. • If a governance solution is found, the Special Escrow Account is closed, and funds transferred to JPB regular account/administration. • If no governance solution is found by September 30, 2021, another $40 Million will be made available for operations. • If no governance solution is found by December 31, 2020, all parties commit to working with the State delegation on a legislative solution in the 2023 legislative session. • The JPB board shall appoint an independent special counsel and auditor (separate from SamTrans) within 90 days of placement of measure on November 2020 Ballot. The item was placed on the City Council’s agenda to discuss sending an additional letter now that the City Council has returned from July recess and following additional details received from staff about other regional bodies taking up the issue closely following the City Council’s August 3 Council meeting. The attached draft letter references the importance of governance to Caltrain’s continued success as a regional asset. Following the approval by the San Francisco Board of Supervisors, the item will be next considered by the San Francisco Municipal Transportation Agency (SFMTA) on July 31, 2020. Other jurisdictions including the Santa Clara Board of Supervisors, Caltrain Board, and Valley Transportation Authority (VTA) are anticipated to have hearing and discussion on this item at their respective scheduled board meetings on August 6, 2020. Policy Implications Caltrain supports the City’s goal of reducing dependence on automobile and the comprehensive Plan 2030 provides for policies and specific actions for reducing traffic congestion and auto emissions by facilitating an increase in transit use. In addition, it envisions a greater emphasis on improving the City’s multi-modal transit connections and expanded Caltrain service in the future. Caltrain service provides a significant alternative to single-occupancy travel to the City of Palo Alto, and the support of it is evidenced in Comprehensive Plan policies and programs: • GOAL T-1 Create a sustainable transportation system, complemented by a mix of land uses, that emphasizes walking, bicycling, use of public transportation and other methods to reduce GHG emissions and the use of single-occupancy motor vehicles. • Policy T-1.1 Take a comprehensive approach to reducing single-occupant vehicle trips by involving those who live, work and shop in Palo Alto in developing strategies that make it easier and more convenient not to drive. • Policy T-1.3: Reduce GHG and pollutant emissions associated with transportation by reducing VMT and per-mile emissions through increasing transit options, supporting City of Palo Alto Page 4 biking and walking, and the use of zero-emission vehicle technologies to meet City and State goals for GHG reductions by 2030. • Policy T-1.5 Support the introduction of autonomous, shared, clean motor vehicles with the goals of improving roadway safety (especially for vulnerable road users), improving traffic operations, supporting core mass transit routes, reducing air pollution and GHG emissions, enhancing transportation opportunities for the disadvantaged and reclaiming valuable land dedicated to motor vehicle transportation and parking. • Policy T-1.10 Support Caltrain modernization and electrification, capacity and service enhancements and extension to Downtown San Francisco. • GOAL T-7 Provide mobility options that allow people who are transit dependent to reach their destinations. • Policy T-7.1 Support mobility options for all groups in Palo Alto who require transit for their transportation. • GOAL T-8 Influence the shape and implementation of regional transportation policies and technologies to reduce traffic congestion and GHG emissions. • Policy T-8.1 Engage in regional transportation planning to reduce congestion and reduce single-occupant vehicle trips, and advocate for specific transit improvements and investments, such as Caltrain service enhancements and grade separations, Dumbarton Express service, enhanced bus service on El Camino Real with queue jumping and curbside platforms, HOV/HOT lanes and additional VTA bus service. • Program T8.1.1 Continue to participate in regional efforts to develop technological solutions that make alternatives to the automobile more convenient. • GOAL L-1 A compact and resilient city providing residents and visitors with attractive neighborhoods, workplaces, shopping districts, public facilities and open spaces. • Policy L-1.8 Maintain an active engagement with Santa Clara County, San Mateo County, neighboring cities, other public agencies including school districts and Stanford University regarding land use and transportation issues. • Policy L-1.9 Participate in regional strategies to address the interaction of jobs, housing balance and transportation issues. • Additionally, one of the Palo Alto City Council priorities for the year is “improving mobility for all.” City of Palo Alto Page 5 Attachments: • Attachment A: Draft Letter to SCC Board of Supervisors Re Caltrain Place on letterhead CITY OF PALO ALTO | 250 HAMILTON AVENUE, PALO ALTO, CA. 94301 | 650-329-2100 August 3, 2020 President Cindy Chavez Santa Clara County Board of Supervisors 70 West Hedding Street East Wing, 10th Floor San Jose, CA 95110 RE: Placing a Caltrain 1/8-cent sales tax measure on the November 2020 ballot Dear President Chavez, On behalf of the City of Palo Alto, I am writing to support placing a one-eighth cent sales tax on the November 2020 ballot in the counties of San Francisco, San Mateo, and Santa Clara so that voters have an opportunity to weigh in on this important topic facing our region. Caltrain is a vital link in the region’s transit network, which provides critical alternatives to single- occupancy vehicle travel. Thousands of essential workers and transit-dependent riders continue to use the service. Improving Caltrain service was always dependent on dedicated funding and discussions with regional partners have continued for several years, with a 1/8-cent sales tax measure as one option to consider. Before the pandemic, Caltrain’s member agencies signaled that they could not afford to increase their contributions, and now their financial situation is even more precarious. We recognize that governance is a longstanding and complex issue. As such we request that Caltrain and Santa Clara County, with other stakeholders, address this issue to extent feasible within the short time remaining prior to the November ballot. A path toward resolution of this issue will require immediate attention and compromise, and is critical to Caltrain’s continued success as regional asset. Caltrain is likely to run out of operating funds before the end of the year and they project a $71 million deficit over the next financial year. As a result of this projected deficit Caltrain is preparing to stop providing service for several years. Voters must have the opportunity to weigh in on imposing a 1/8- cent sales tax measure and as a regional partner, we urge the Santa Clara County Board of Supervisors to let voters decide whether to financially support Caltrain service through this long-term financial option. Sincerely, Adrian Fine Mayor City of Palo Alto Place on letterhead CITY OF PALO ALTO | 250 HAMILTON AVENUE, PALO ALTO, CA. 94301 | 650-329-2100 Cc: Peninsula Corridor Joint Powers Board San Francisco Mayor London Breed San Jose Mayor Sam Liccardo San Mateo County Board of Supervisors San Francisco Board of Supervisors San Francisco Municipal Transportation Agency Board of Directors San Mateo County Transit District Board of Directors Santa Clara Valley Transportation Agency Board of Directors City of Palo Alto (ID # 11433) City Council Staff Report Report Type: Informational Report Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: City of Palo Alto 2020 Water Gas and Wastewater Utility Standards Title: City of Palo Alto 2020 Water Gas and Wastewater Utility Standards From: City Manager Lead Department: Utilities This is an informational report and no Council action is required. Background The City of Palo Alto Utilities (CPAU) Department’s Water, Gas, and Wastewater (WGW) Engineering Division implements standard specifications and details to regulate construction of water, gas, and wastewater facilities in the public right-of-way and for CPAU-owned facilities on private properties. These standards ensure that utility infrastructure is constructed and maintained in a safe, uniform, and reliable manner. The WGW Utility Standards include installation requirements, material specifications, and standardized configurations. Discussion CPAU Engineering staff updates the WGW Utility Standards periodically and last issued revisions in 2019. This 2020 edition incorporates current field practices, contract management, and other non-substantial changes which can be viewed at this link (LINK). The most significant revisions to the 2020 WGW Utility Standards are summarized below: • Reworded some phrasing and added new language to increase clarity of standards and requirements (in various Sections). • Included additional language to clarify Contractor’s responsibilities on construction projects to help City manage capital improvement project (CIP) contracts (in various Sections). • Changed the construction submittal format from hard copies to electronic files and added a requirement for the contractor to submit them within 10 working days from the date the Contract is signed (Section 800). • Highlighted the testing and certification requirements for contractor personnel City of Palo Alto Page 2 performing work on natural gas facility or pipe-bursting operation (Section 800). • Rearranged the order of specifications based on the sequence of events (Section 2200). • Strengthened the potholing requirement to locate crossing and parallel utilities within 5 feet of the proposed utility to minimize construction conflicts. Also contractor’s responsibility to fully examine and inspect project site to identify and anticipate public and private utilities within the project area to avoid unnecessary dig-ins/damage (Section 2200). • Specified the requirements for working around PG&E high pressure main and CPA high voltage electric duct bank (Section 2200). • Clarified the polyethylene pipe marking requirements (Section 2300). • Added the specification for temporary line stops on water mains (Section 2660). • Added the specification for marking tape, pressure control fittings, drilling nipples, vent pipe, pressure testing of new service connected to PVC main, and abandonment procedures (Section 2685). • Detailed the gas system operator qualification testing requirements (Section 2685). • Added requirement for flow monitoring and hydraulic analysis of wastewater main for large development projects (Section 2730). • Strengthened the requirements for cured-in-place liner installation in wastewater main (Section 2736). • Added sewer manhole abandonment procedures (Section 2738). • Strengthened cleaning equipment requirements and procedures for cleaning wastewater mains (Section 2739). • Clarified the basis of survey control benchmarks for GPS data collection (Section 2740). • Detailed the requirements to clear obstructions in wastewater main prior to performing cross bore inspection (Section 2741). • Added hydraulic butt fusion procedures (Appendix F). The 2020 City of Palo Alto Water Gas and Wastewater Utility Standards are available on the City’s website at www.cityofpaloalto.org/gov/depts/utl/eng/standards.asp. City of Palo Alto (ID # 11522) City Council Staff Report Report Type: Informational Report Meeting Date: 8/3/2020 City of Palo Alto Page 1 Summary Title: City Council Recess Summary Report Title: City Council Recess Summary Report From: City Manager Lead Department: City Manager Discussion The following informational report provides a brief update on activities accomplished during the City Council’s July recess. The updates are organized by department. While the summary is not an exhaustive list of staff activities, it seeks to inform the City Council and the broader community about items completed since the last City Council meeting of the fiscal year or recent efforts underway. The report is transmitted with the August 3 City Council meeting packet. Administrative Services Department End of Fiscal Year and New Fiscal Year Activities: Over the past 6 weeks, ASD staff have been hard at work transitioning from one fiscal year to a new fiscal year, it is the “New Years” for financial staff. Not only has staff completed the normal review of contracts and revenues and expenses to begin the comprehensive annual financial report for FY 2020 and begin the FY 2021 fiscal year, they have completed the annual inventory of both warehouses at the Municipal Services Center and Regional Water Quality Control Plant (RWQCP) requiring the physical count of inventory with no material discrepancies; implemented the new employment contracts for payroll processing including the management and professional concessions such as the vacation limit and furlough adjustments as well as the new Family First Corona Virus Relief Act (FFCRA) with the sunset of the administrative leave provision on June 30, 2020. Other Administrative Activities: Other staff activities included the submittal of certification for CARES Act funds as designated by the Governor’s Office of $845,000 as outlined in his May revise budget approved by the legislature in late June 2020. Processed and issued 48 small business grants to date totaling $477,000 with an cross functional team pulled together for this special project. Staff remotely processed over 360 parking permit renewals for the first time in the University Avenue and California Avenue districts. As well as completed configurations and preparations for a new pilot on-line parking permit program. As a smaller parking permit area, staff selected College Terrace as a testing opportunity to pilot the online system that will go live on Monday, August 3. Revenue Collections and Transportation staff training on the new system will conclude by July 31. City Manager’s Office City of Palo Alto Page 2 Race and Equity Framework Progress: The City Manager’s Office continues to move forward several efforts focused on Race and Equity, including a series of community engagement opportunities. In addition, all Council Ad Hoc committees have met over the July recess and an update is tentatively scheduled for August 24 for further Council input and community feedback. Staff recently was accepted as a member of the Government Alliance on Race and Equity (GARE) to take our race and equity efforts further through training, learning from other agencies and best practices employed. Staff has begun implementing a series of ways for the community to join the conversation on race and equity and additional planning is underway. The approaches range from panel discussions, Q and A sessions, speaker series, and public forums, to digital conversations through a social media campaign and online forum over the next several months. A brief description and timeline of the conversations and events are listed below: Police Community Briefings began on July 1 and are a series of four learning sessions. YouTube comments are open for the public to comment. Police Department Introduction: July 1, Use of Force: July 8, Search and Seizure: July 15, and Transparency and Accountability: July 22 Q and A session with Kaloma Smith, City Manager Ed Shikada, and Chief Jonsen- completed on July 2 and available here. The recorded event is available on YouTube and community comments are still being taken. 8 Can’t Wait Panel Discussion, hosted by the Human Relations Commission – completed on July 9 and available here. Panel included: • Chief Robert Jonson – Palo Alto Police Department • David Alan Sklansky - Co-Director of Criminal Justice Center Stanford • Kenan Moos - Justice Vanguard Foundation • Matthew Clair – Assistant Professor of Sociology, Stanford University • Anand Subramanian - Managing Director, Policy Link 8 Can't Wait Review with the Human Relations Commission and Public Forum- completed on July 22 and available here. Review by staff and HRC public forum took place. Recommendations and input received will be presented to the City Council during a study session tentatively scheduled on August 24. Human Relations Commission Public Forum on the Current and History of Black and Brown Community Experiences: August 13. Discussion and public forum sharing experiences is planned. City social media campaign and online forum will complement this conversation by encouraging experiences sent via video or other digital mediums to share with the commission. Author Series – Palo Alto Reads: In partnership with Stanford University, the Palo Alto Library is hosting an author series in August and exploring other author talks for September focused on race and equity. Library youth and teen programming will be offered around this author series focused on inclusion and diversity. City of Palo Alto Page 3 Expanded Communications: Staff is currently working on a series of communications to engage and inform on race and equity. A few examples include a new website: www.cityofpaloalto.org/raceandequity, initial Blog post and Additional blog post. Staff is also encouraging email input by emailing the City Manager’s Office here: raceandequity@cityofpaloalto.org. Summer Streets Program Progress: Reopening and recovery work continues as we implement the City Council’s priorities of supporting our community and uplifting local businesses during this challenging time. Staff coordination includes one on one meetings, weekly check-in meetings with Cal Ave and University Avenue/Downtown core businesses. An online survey, direct email correspondence and site visits were also conducted to gain an ongoing understanding of how the street closures, signage, parklets and other efforts are impacting restaurants, retail stores and other business operations. Changes to the program continue to be made based on business input. In addition, we’ve offered community check-in meetings via Zoom and an online survey for the community to also provide feedback on their experiences. Print and digital advertising is underway to promote the program and encourage local and regional visitors to eat, shop and celebrate summer, supporting local businesses safely through the summer months. For additional details, go to www.cityofpaloalto.org/summerstreets Community Services Department Summer Camp Progress: The Community Services Department launched virtual and in-person summer camps in July. Camps include music, dance and theatre (7 camps/11 sessions), art (4 camps/12 sessions), science (4 camps/11 sessions), and sports/recreation (13 camps/18 session). Special interest camps are also offered (7 camps/9 sessions). All in-person camps are following social distancing and hygiene guidelines in the most recent County Health Order. Community Programming Continues: CSD continues to provide opportunities to engage the community through programming. Examples include a potter’s wheel rental program (Art Center), virtual theatre performances (Children’s Theatre), and a mural event for teens called “What Keeps You Afloat?” (Children’s Theatre). Public Art Installations Underway: The Public Art program was busy with the Black Lives Matter mural initiative, a Public Arts Commission-led effort; installing the public art at the new Junior Museum and Zoo; and restoring The Boy with a Fishing Pole mural (Greg Brown) on the side of the downtown Post Office. Commission Coordination: Staff are working closely with the Public Art Commission and Human Relations Commission to respond to Council referrals on Black Lives Matter and 8 Can’t Wait. The Human Relations Commission hosted two community conversations around police practices in July on July 9 and July 22. Go here for their meeting details including recordings of the conversations. Parks and Recreation Commission Coordination: Parks and Open Space staff assisted the Parks and Recreation Commission to host a panel discussion on July 28 related to Foothills Park access to nonresidents. The City Council will discuss this topic on August 3. Cubberley Coordination and Tenant Support: Staff worked closely with Palo Alto Unified School District (PAUSD) to find suitable room assignments for each long-term tenant that was displaced from Cubberley City of Palo Alto Page 4 due to the new lease agreement. In addition, staff was recently notified that two tenants are closing due to impacts from COVID-19 and staff is evaluating space usage. Staff is also working on a prioritization policy for Cubberley hourly renters. PAUSD will also allow hourly rental use of several rooms to frequent past renters. Office of Emergency Services Emergency Services Activities: OES staff continues to monitor the ongoing pandemic emergency, participating in County EOC conference calls, coordinating with other regional partners, and tracking emerging trends. Staff is working with the County specifically on new opportunities to expand COVID-19 testing in Palo Alto in August and September. OES is also continuing the mission to prevent, prepare for, respond to, and recover from all hazards. The threats of wildland fire, terrorism, cyber, and numerous other hazards continue, even as most people focus on the pandemic. See www.cityofpaloalto.org/thira. OES has also made progress on the grant- funded Solar Generator Trailer project, with the RFP concluded, the vendor selected, and delivery expected in early 2021. OES is also continuing to conduct socially-distanced training for our Emergency Services Volunteers (ESV), a program that is continuing to add members during this pandemic. Fire Department Hog Fire Strike Team Redeployment: On the morning of July 21 the Palo Alto Fire Department received a mutual aid request from Contra Costa County to join a strike team responding to the Hog Fire located west of Susanville near the Hog Flat Reservoir in Lassen County. The Palo Alto four-member crew assigned to the event includes a Captain, Engineer, Firefighter Paramedic and Firefighter. PAFD Engine 365 returned from their strike team deployment to the Hog Fire on July 29. As of July 30, the Hog Fire is currently 9565 acres and 82% contained. Human Resources Department Human Resources Activities: As a result of fiscal challenges and revenue shortfalls reflected in the adopted budget, HR staff completed position reductions and layoffs impacting up to 7 full time employees and 53 hourly employees. Staff are continuing to facilitate the redeployment of impacted employees to help minimize employee separations. Staff was able to work with union leadership to defer 15 public safety employee layoffs, through a combination of a Public Safety early retirement program, salary concessions and other measures. Staff also assisted with implementing furloughs and salary freezes for Management and Professional Employees. At the same time, staff supported critical recruitments to ensure stable staffing in critical services including planning and building inspectors. Human Resources staff also partnered with Community Services to hire and on board approximately 30 hourly employees to launch this year’s summer camps. Staff is leading evaluation of the newest County protocols related to COVID-19. Library Department Recent Library Award Announced: Palo Alto Library’s Robotics in Libraries has been selected to receive an Outstanding Achievement in Local Government Innovation Award from the Alliance for Innovation! City of Palo Alto Page 5 Sidewalk Service Continues: The library began Sidewalk holds pickup services at Mitchell Park and Rinconada branches from June 26. More than 14,000 items have been picked up by community members. Palo Alto Reads Program Planning: The Library is honored to announce its first virtual Palo Alto Reads event and book selection, The Color of Law: A Forgotten History of How Our Government Segregated America by Richard Rothstein. Published in 2017, The Color of Law tells the history of the design and segregation of American communities along racial lines. Rothstein focuses on many Bay Area communities, including Palo Alto, which thwarted efforts back in 1947 to create integrated and working- classing housing near Stanford University. This historical book provides great context into exploring today’s ongoing inequities in housing, education, income and health. From August 15 to September 15, free copies of The Color of Law will be available at Mitchell Park and Rinconada Libraries during Sidewalk Service hours. We hope that Palo Alto joins in this community read and conversation. We will be offering a series of events for all ages during this time, including a virtual conversation with author Richard Rothstein on Thursday, August 27 at 7 p.m. This author event is sponsored and hosted by The Bill Lane Center for the American West of Stanford University. Palo Alto Reads is joint partnership with the City of Palo Alto and its Race & Equity Initiatives. Many thanks to the City, Stanford University and the Friends of the Palo Alto Library for their support! Library Book to Action Program Launched: Palo Alto Library was chosen out of a competitive field of applicants to participate in Book to Action, a California Center for the Book/California State Library program that takes the book club concept and expands it into a series of events for adults and intergenerational groups. For our program, we selected the adult graphic novel Wrinkles by Paco Roca, and have put together a series of events designed to generate empathy and inspire connection with the Seniors in our community. Starting this week, we will be making copies of Wrinkles available to patrons (for free!) while supplies last. Library Virtual Events and Other Programming: The Library hosted 29 live/interactive events with 2367 attendees virtual events. Virtual Storytimes started on July 6 and run Monday-Friday at 11 AM on Facebook Live. We’ve had 12 events with 1816 views. Summer Reading Program launched on July 1 with 817 signups so far. Our 3 Wacky Wednesdays have attracted 408 attendees and our special SRP videos (First Chapter Fridays and Saturday Crafternoons) have attracted 880 views. Planning and Development Services Department Regional Housing Needs Allocation (RHNA) and Plan Bay Area 2050: The City Council received an informational report regarding these two regional planning processed. City Council will hold a public meeting on August 3. Public comments on the Plan Bay Area 2050 draft Blueprint are due on or before August 10. Summer Streets: The Summer Streets program, kicked off by Council adoption of a resolution and interim urgency ordinance, has been well-received by businesses and community members. On California Avenue and University Avenue, dining al fresco has become the new modus operandi. In addition, over 20 applications for parklets have been received, reviewed, and/or issued. Five parklets have been constructed and are currently serving patrons. Likewise, several private and public parking City of Palo Alto Page 6 spaces have been repurposed as outdoor dining or retail areas. The Council will receive an update and consider program modifications on August 10, 2020. Inspection Services: The City has received numerous complaints about the delay in scheduling inspections for construction projects. While recruitment is underway for two new inspectors (one is limited term) authorized by the City Council during the budget process, staff has onboarded additional consultant inspectors using salary savings. Efforts to reduce the backlog have been successful. The waitlist has been reduced from 6 weeks to approximately 1 week. The City’s inspection manager and even our Chief Building Official have conducted inspections to help better serve our customers. Online Permitting Services System: The Online Permitting Services System began as a temporary measure to respond changes in the shelter in place protocols. It has enabled many customers to submit plans and review comments electronically. Staff review of the system is underway to address customer issues raised and staff is creating a series of online tutorials to make the system more accessible. The Online Permitting Services system is moving from a temporary tool to one that can sustain us over the duration of the pandemic and through recovery. This year, the department will issue a request for proposals for a more permanent online solution. Castilleja School: The Final Environmental Impact Report for Castilleja was released on July 29. Public hearings on the project will begin with the Architecture Review Board on August 20 followed by the Planning and Transportation Commission on August 26. A significant amount of public engagement is anticipated, and it will take several meetings each of these bodies and the HRB before the project advances to the City Council in November (tentative). High Speed Rail Project Draft Environmental Impact Report Released: The California High Speed Rail Authority has released a DIER/EIS for the project section between San Francisco and San Jose. The public comment period ends August 24, 2020. City staff led by the Office of Transportation, are reviewing the document and anticipate sending a comment letter. More information and access to the document is available here. 340 Portage (Former Fry’s Site) Application Filed: An application was received requesting a zoning text amendment to allow more flexible use of the space vacated Fry’s Electronics. The applicant indicates Target has a strong interest to occupy about 30KSF of the building and requests code language precluding the expansion of other land uses, including office, be removed. The property is zoned RM-40 but is allowed to maintain commercial uses through a provision written into the City’s zoning code. No hearing dates are scheduled at this time. 788 San Antonio Housing Project Application: This application for 100 units and possible extension of the Housing Incentive Program along portions of San Antonio is schedule for hearings before the Planning and Transportation Commission on August 12, 2020 and Architectural Review Board on August 20, 2020. This is a legislative and quasi-judicial project that will also be scheduled before the City Council tentatively in October. North Ventura Coordinated Area Plan (NVCAP): The NVCAP Working Group has continued virtual meetings, which started in May 2020. The Working Group has used small, subcommittee meetings to work towards consensus on several important topics. The Working Group will continue meeting in August. In September and October, staff and the consultant team will translate the outcomes of the City of Palo Alto Page 7 subcommittee meetings into at least 2 draft alternatives that will be presented to the Planning and Transportation Commission, and ultimately City Council. Wireless Ordinance: Prior to the coronavirus pandemic, staff was on schedule to present this ordinance to Council in April. Early cancellation of the PTC meetings and need to shift staff resources to other priorities resulted in delays to the schedule. Staff anticipates bring a draft resolution to the PTC following its request to meet with industry officials and make some adjustment to the ordinance. Those hearings will resume in September/October and be presented to the City Council around November. East Palo Alto University Avenue Office Project: City staff responded to a Notice of Preparation to prepare an Environmental Impact Report for the University Circle Phase II Office Project proposed at the corner of University Avenue and Woodland Avenue in East Palo Alto. The project proposes to redevelop an existing parking lot located in the southeast corner of the project site with a six-story, approximately 180,000-square-foot office building above three levels of below grade parking. The tenant(s) for the office space are not yet known. City of Palo alto Staff anticipates that the project will result in both construction and operational traffic impacts that would affect residents within the City of Palo Alto and has requested that a traffic analysis be prepared to analyze these local traffic impacts. The City also requested that the City of East Palo Alto identify and address other impacts that may affect the quality of life of residents within Palo Alto as a result of construction or operation of the proposed project. They include but are not limited to: air quality, aesthetics, noise, and parking. The Notice of Preparation is the beginning phase of an environmental review process. There will be additional opportunities to provide public input in the future. Staff anticipates that the City of Palo Alto will review and provide a formal comment letter on the Draft Environmental Impact Report once it is published. Police Department Police Community Briefings: For the first time, the Police Department delivered four separate live presentations to the public via Zoom and YouTube during the month of July to share department details. The series of one-hour online community briefings offer insight into the Police Department and some aspects of law enforcement. The community briefings are loosely based on the curriculum provided in the Police Department’s popular Basic Citizens Police Academy and takes community members on a deep dive into law enforcement topics as a foundation to upcoming broader community briefing sessions. Chief Robert Jonsen, Assistant Chief Andrew Binder, and Acting Captain James Reifschneider each hosted at least one of the sessions, all of which can be watched on the PAPD YouTube channel: Overview of PAPD, Use of Force Policy and Use of Force Investigations, Laws of Arrest and Search & Seizure, and Accountability Within PAPD. Participated in Ongoing Race and Equity Conversations: Led by Chief Robert Jonsen and joined by other members of the PAPD executive staff, the Police Department spent much of July participating in the ongoing race and equity conversations occurring in our community. PAPD participated in multiple meetings of the four City Council Ad Hoc Committees, made presentations and addressed questions at two public meetings of the Human Relations Commission, and participated in two community City of Palo Alto Page 8 roundtable discussions on racial and social injustice in America hosted by the Mid-Pen Media Center. The Police Department looks forward to continuing to participate in these important conversations as we move into August. Response to Fireworks Complaints: During the shelter-in-place period, there has been a rise across the United States in the number of illegal fireworks, and the Palo Alto area has been no exception. Our officers routinely responded to fireworks complaints from residents, but unfortunately the fireworks were only heard or seen in the sky, and the location from which they were being launched was most often in adjoining cities. The Police Department joined other City departments in launching a public education campaign targeting the illegality of fireworks and the ramifications and dangers that illegal fireworks bring to communities. For more information, see the City’s new web page dedicated to this ongoing problem here. Public Works Services Department Bike Bridge Construction Continues: The construction contract for the Highway 101 pedestrian/bike bridge was approved in November 2019 and construction started this year in February. During July, utility relocations that required a new joint trench were completed on the West Bayshore side. On the East Bayshore side, construction of all 16 foundation piles was completed, and column construction is in progress and is visible. Fabrication of the main span steel bridge over Highway 101 and the smaller Adobe Creek bridge is underway. California Avenue Garage Progress: Steady progress has continued over the summer and we expect the garage to be completed by late September. The remaining work includes the grand staircase facing Birch Street, terra cotta exterior architectural elements, elevators, parking stall striping, landscaping and signage, the parking guidance system, and the garage’s 32 EV chargers. Deconstruction Ordinance Began July 1, 2020: A new Palo Alto Deconstruction Ordinance became effective on July 1, requiring that certain large projects separate materials as a building is taken down, rather than demolishing it in in the old-fashioned way. Deconstruction, rather than demolition, allows for more salvaging and recycling; reduces landfilling; conserves materials and resources; and helps implement the City’s Zero Waste and Sustainability /Climate Action Plans. The July 1 date is the first phase of this initiative and includes projects that are taking down an entire building, where the Building permit is applied for after July 1. Staff expects about 115 projects per year; maybe less this year with COVID-19 induced delays. Since July 1, there have been five Building permit applications submitted which will trigger deconstruction; all of which are single family residential. Palo Alto is one of the first cities, nationally, to implement this program. Additional information, outreach materials, and resources are available on the City’s website, by emailing Deconstruction@CityofPaloAlto.org, or by calling (650) 496-5910. Office of Transportation Transportation Data Counts: Transportation conducted data counts to determine detour traffic due to Summer Streets closures on University Avenue. Staff also conducted ongoing parking counts to evaluate the impacts of summer streets closures on parking demand and led pedestrian and bicycle data counts in the Cal Avenue and University Avenue areas to determine related impacts. Data collected will be City of Palo Alto Page 9 presented to the City Council as part of the August 10 City Council meeting item on the Summer Streets program. Rail Virtual Town Hall: Office of Transportation, AECOM, and the City Manager’s Office is working to develop a virtual Town Hall to discuss grade separation (Connecting Palo Alto) that will occur in mid- August. This online opportunity will catch up the community on what’s new and provide a new opportunity virtually to inform and engage on the City’s Grade Separation conversations in advance of moving to the next phase of this initiative. Rail Expanded Community Advisory Panel (XCAP) Meeting Progress: XCAP meetings have continued through the summer. The XCAP is starting to draft their final report and nearing deliberation of grade separation alternatives. XCAP plans to provide an update to Council in September. Caltrain Fiscal Challenges: Staff has been tracking Caltrain fiscal challenges including the potential placement of an 1/8 cent sales tax measure on the November 2020 ballot. This topic is added to the August 3 City Council meeting to consider and discuss next steps. Parking Updates: Staff has renegotiated contract parking enforcement with a significant cost savings, as described in the budgeting process. The contract with SP+ has been terminated and is in the process of switching the Residential Preferential Parking (RPP) permit process to a new vendor (Duncan) for virtual permitting. Staff is preparing to switch to the virtual permits using License Plate Recognition (LPR) technology and will return to Council with more details. Parking programs policy review is underway and will return to Council for review. In addition, the new Cal Ave garage will be opening this fall, and staff will return with plans for permit distribution and potential changes to the neighboring Residential Permit Program. Automated Parking Guidance Systems will be implemented in the new Cal Ave garage and the process for implementing a similar system in downtown is being developed. Transportation Planning: Transportation Demand Management (TDM) Ordinance development is underway, and the Planning and Transportation Commission recently reviewed the proposed ordinance during a study session. Staff plans to return to PTC with the TDM ordinance in the first half of the year and to the City Council afterwards. The Safe Routes to School program has developed online resources and provided virtual lessons and trainings. Currently staff are preparing to re-align typical plans with the school districts plans. Due to COVID-19, the bike/scooter share program has not initiated. Staff plans to request Council to extend the pilot. Transportation Engineering: Staff is working on contracts to continue Capital Improvement Projects and will return to council for approval of contracts. The Crescent Park neighborhood traffic calming pilot project will go to the Planning and Transportation Commission for review, followed by Council. Staff expects to bring a contract award to Council for approval for the Alma/Churchill Rail safety Section 130 grant-funded project soon. Utilities Department Utilities Staffing: Approximately half of the Utilities department staff have returned to work and half of the staff continue to work remotely. Almost all Operations staff are physically reporting to work to carry out field maintenance and operations projects and respond to emergency service calls. Customer Support Service staff rotate in and out of the office. Staff in the Administration, Resource Management City of Palo Alto Page 10 and Engineering divisions are mostly working remotely, although some are choosing to return to in- person work. Utilities had suspended reading meters in backyards and behind locked facilities in accordance with the shelter in place requirements but resumed all meter reading at the beginning of June once some of the restrictions were lifted. Modifications to Utilities Programs: When the County lifted restrictions on construction activities, some energy efficiency projects resumed this summer, including commercial energy efficiency projects, solar installations, EV charger installations, and other work that does not require staff or consultant visits inside occupied residential dwellings. The County’s construction protocol requirements continue to be in effect. Since all visits inside occupied residential dwellings are temporarily on hold, staff are modifying programs to offer virtual services. Saving Energy and Water While Sheltering in Place: Utilities launched an outreach campaign with energy and water efficiency tips to help keep bills low while people are working and studying from home. A new “Summer Sustainability for Kids” e-newsletter series aims to educate younger Palo Alto community members and provide family-friendly activities for children as they spend more time at home this summer. Utilities Projects Progress: Each year Utilities performs a routine inspection of the gas distribution system to check for leaks and contractors are currently walking residential areas for this inspection. Staff are replacing utility poles in various areas of the city. In addition, the utilities meter audit project continues and is expected to wrap up in the fall. Timeline, Resource Impact, Policy Implications N/A Stakeholder Engagement N/A Environmental Review This report is not subject to environmental review.